KEGG   Mus musculus (mouse): 56543Help
Entry
56543             CDS       T01002                                 

Gene name
Kcnd3, AW045978, Kncd3, Kv4.3
Definition
(RefSeq) potassium voltage-gated channel, Shal-related family, member 3
  KO
K04893  potassium voltage-gated channel Shal-related subfamily D member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    56543 (Kcnd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    56543 (Kcnd3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   56543 (Kcnd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3399 Ion_trans BTB_2 Shal-type Ion_trans_2 BTB_3 PKD_channel
Motif
Other DBs
NCBI-GeneID: 56543
NCBI-ProteinID: NP_064315
MGI: 1928743
Ensembl: ENSMUSG00000040896
Vega: OTTMUSG00000026532
UniProt: Q9Z0V1 B2RUE0
Position
3; 3 F2.2
AA seq 655 aa AA seqDB search
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY
TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEQMGKTTSLIESQHHHLL
HCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHS
GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTLHIQGSEQPSLTTSRSSLNLKADDG
LRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSITSNVVKVSAL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaggagttgcagcctggctgccttttgcccgggctgcggccattggatggatg
ccagtggccaactgccccatgcccctagctccagcggacaagaacaagcggcaagacgag
ctgatcgtcctcaacgtaagtggacgacggttccagacctggaggaccactctggagcgc
tatcccgacaccttgctgggtagcacagagaaggagttcttcttcaatgaggacacgaag
gagtacttctttgaccgtgacccggaagtgttccgttgtgtgcttaacttctaccgcacc
gggaagctgcactacccacgctatgaatgcatctctgcctacgacgatgaactggccttc
tatggcatcctccccgagatcatcggagactgctgctacgaggagtacaaagaccgcaag
cgggagaatgcggagcggctcatggatgacaatgactctgaaaacaaccaggagtccatg
ccctctctcagcttccgtcagaccatgtggcgggccttcgagaacccacacaccagcacc
ctggcactggtcttctactatgtgactggcttcttcattgccgtctcggtcatcaccaat
gtggtggagacggtgccttgcggcaccgtgcctgggagcaaggagctgccgtgtggagag
cgctattcggtggctttcttttgcctggacactgcctgtgtaatgatcttcacagtggag
tacctcctccgactctttgcggcacccagcagataccgcttcatccgcagtgtgatgagc
attatcgacgttgtggccatcatgccctattacattggcctggtcatgaccaacaatgag
gacgtgtctggggcatttgtcacactccgggtcttccgtgtcttcaggatcttcaagttc
tcccgacattcccagggtctacggatcctgggctacaccctgaagagctgtgcctcagaa
ctgggctttcttctcttctcccttaccatggccatcatcatctttgccactgtgatgttt
tatgctgagaagggctcctctgccagcaagttcacaagcatccctgcatctttctggtac
accatagtcaccatgactacactgggatatggagacatggtgcctaagacaatcgcaggg
aagatatttggctccatctgctccctcagcggtgtcctggtcattgccctgccggtccct
gtgatagtctccaactttagcaggatctaccaccagaatcagagagcagataaacgcagg
gcacaaaagaaggcccgccttgccaggatccgggtggccaaaacgggaagctccaatgcc
tacctgcacagcaagcgcaatgggctcctcaatgaggccctggagctgacgggcacccca
gaagaggagcagatgggcaagaccacctcactcatcgagagccagcaccaccacctgcta
cactgcttagaaaagaccactgggttatcctatcttgtggatgatcccctgttatctgta
cgaacctccaccatcaagaaccatgagtttattgatgagcagatgtttgagcagaactgc
atggagagctcgatgcagaactacccctccaccagaagtccttctctgtccagccactcg
ggcctcaccaccacctgctgctcccgtcgtagcaagaagaccacacacctgcccaactct
aacctgcctgccacccgcctgcgcagcatgcaggagctcagcacgctccacatccagggc
agcgagcagccctccctcaccaccagtcgctccagccttaatttgaaagcagacgatgga
ctgagaccaaactgcaaaacatcccagattaccacggccatcatcagcatccccaccccc
ccagctctgacccccgagggagaaagtcggccaccccctgccagcccaggccccaacacg
aacattccttccataaccagcaatgtcgtcaaggtctctgccttgtaa

DBGET integrated database retrieval system