KEGG   Mus musculus (mouse): 56544
Entry
56544             CDS       T01002                                 

Symbol
Vmn2r1, Casrl1, EG56544, V2r83
Name
(RefSeq) vomeronasal 2, receptor 1
  KO
K04613  vomeronasal 2 receptor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    56544 (Vmn2r1)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Vomeronasal pheromone
    56544 (Vmn2r1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Other DBs
NCBI-GeneID: 56544
NCBI-ProteinID: NP_064302
MGI: 3645892
Ensembl: ENSMUSG00000027824
Vega: OTTMUSG00000039823
UniProt: O70410 G3X8Y6
Position
3; 3 E1
AA seq 912 aa
MASRQISLALGFLAFLWAVLGAQNKTEEVQCRLMAKFNLSGYVDAKNHSLVIAGLFPIHS
RIIPVDEAILEPVSPMCEGFNFRGFRWMKTMIHTIKEINERKDILPNHTLGYQIFDSCYT
ISKAMESSLVFLTGQEEFKPNFRNSTGSTLAALVGSGGSSLSVAASRILGLYYMPQVGYT
SSCSILSDKFQFPSYLRVLPSDNLQSEAIVNLIKHFGWVWVGAIAADDDYGKYGVKTFKE
KMESANLCVAFSETIPKVYSNEKMQKAVKAVKTSTAKVIVLYTSDIDLSLFVLEMIHHNI
TDRTWIATEAWITSALIAKPEYFPYFGGTIGFATPRSVIPGLKEFLYDVHPNKDPNDVLT
IEFWQTAFNCTWPNSSVPYNVDHRVNMTGKEDRLYDMSDQLCTGEEKLEDLKNTYLDTSQ
LRITNNVKQAVYAIAHGLDHLSRCQEGQGPFGSNQQCAYIPTFDFWQLMYYMKEIKFKSH
EDKWVILDDNGDLKNGHYDVLNWHLDDEGEISFVTVGRFNFRSTNFELVIPTNSTIFWNT
ESSRRPDSFCTQVCPPGTRKGIRQGQPICCFDCIPCADGYVSEKPGQRECDPCGEDDWSN
AEKSKCVPKLVEFLAYEEALGFTLVILSIFGALVLLAVTVVYVIHRHTPLVKANDRELSF
LIQMSLVITVLSSLLFIGKPCNWSCMARQITLALGFCLCLSSILGKTISLFFAYRISVSK
TRLISMHPIFRKLIVLICVVGEIGICAAYLVLEPPRMFKNIEIQNVKIIFECNEGSIEFL
CSIFGFDVLLALLCFLTTFVARQLPDNYYEGKCITFGMLVFFIVWISFVPAYLSTKGKFK
VAVEIFAILASSYGLLGCLFLPKCFIILLRPKRNTDETVGGRVPTVDRSIQLTSASVSSE
LNSTTVSTVLDE
NT seq 2739 nt   +upstreamnt  +downstreamnt
atggccagcagacagataagcttagctttaggatttcttgcatttttgtgggctgtattg
ggtgctcaaaacaaaacagaggaagtacaatgcagattgatggccaagtttaatttgtct
ggatatgtagatgccaaaaatcattcacttgttattgcaggactgtttcctatccactcc
agaatcatcccagtagatgaagctattttggagccggtatcacccatgtgtgaagggttt
aatttccggggtttccgatggatgaaaaccatgatccacaccattaaggagattaatgag
aggaaggacattttgcccaaccatactctgggctaccagatctttgattcctgctatacc
atctccaaagcaatggagtcatctttggtgtttcttactgggcaggaagaattcaaaccc
aattttagaaatagcactggatcaactctagcagcactggttggatcagggggatcatct
ttgtcagttgctgcttcacgaattctagggttgtattatatgcctcaggtgggctatact
tcttcctgctcaattcttagtgacaaattccagtttccatcttatcttcgtgtactaccc
agtgataacctccagtctgaggccatagtgaatctcatcaaacacttcggttgggtctgg
gtaggtgctattgcagctgatgatgattatgggaaatatggagtaaaaacttttaaggaa
aaaatggagagtgccaacctctgtgttgctttctctgaaaccattcccaaagtctactcc
aatgagaaaatgcagaaggctgttaaggcagtaaagacttccactgccaaagtcattgtg
ctttatacttctgacattgacctcagcctgtttgtgctggaaatgattcatcataacata
actgacaggacatggatagccaccgaagcctggattacctctgctctcattgcaaagcct
gagtatttcccctattttggtggaactattggatttgcaacaccaagaagtgttatacca
ggactaaaagaatttctttatgatgtacaccctaacaaggatccaaatgatgtcttgacc
attgaattctggcaaactgcttttaactgtacctggcccaacagcagtgttccttataac
gtggatcacagagtgaatatgactgggaaagaagacagactgtatgacatgtctgatcag
ctctgcactggagaggagaagctggaagatctgaaaaacacctatctggatacatcacag
ctaagaattacaaacaatgtcaaacaagctgtatatgctatagctcatggcctggatcat
ctcagcagatgtcaagaagggcagggaccatttggttcaaatcagcaatgtgcatatata
cctacctttgatttctggcagctaatgtactatatgaaagaaattaaatttaaatcacat
gaggataaatgggtaattctggatgataatggagatttgaaaaatggacactatgatgtc
ctaaactggcacttagatgatgagggagaaatttcctttgtgacagttgggagatttaac
tttagatctacaaactttgagcttgttattccaacgaattctacaatattttggaacact
gagtcatcaaggcgtccagattcattttgcacacaagtgtgtcctccagggacccggaag
gggattcgtcaggggcaacccatatgctgctttgattgcatcccatgtgctgatggatat
gtgtcagagaaaccaggacagagggaatgtgatccatgcggtgaagatgactggtccaat
gcagagaagagcaagtgtgtgccaaagcttgtggaattcctcgcttatgaagaggcactg
gggttcactcttgtcatcctgtccatctttggggcacttgtcctcttggcagtaactgtt
gtgtatgtgatccacagacacactccattggtgaaagccaatgaccgggagctgagcttc
ctcattcagatgtctctggtcatcactgtgctgtcttccttgctgttcataggcaagcca
tgcaactggtcctgcatggcccgccagatcactctggcactcggcttttgcctttgtctg
tcttccattcttggaaagactatttcactcttttttgcctataggatttctgtatctaaa
acccgtcttatatccatgcaccccatttttcgaaaattaattgtactgatctgcgttgta
ggggagattggtatatgtgcagcatacttggtgttggagcctccaaggatgttcaagaac
attgaaattcaaaatgtaaagatcatctttgaatgcaatgaaggttctatagagtttctg
tgctccatatttgggtttgatgttctcctggctctgctgtgttttcttacaacctttgtg
gctcgccagctgccagataactattatgaagggaaatgtatcacttttgggatgctggtc
tttttcattgtctggatctcttttgtccctgcttacttgagcaccaaaggcaaattcaaa
gtggctgtggaaatatttgccattttggcatctagctatggcttgttaggctgtctattt
cttcccaagtgcttcattatcttgctgaggccaaagaggaacactgatgaaactgttggt
ggaagagtccccactgttgacaggagcatccagctgacctcagcttctgtgagcagtgag
cttaacagcaccacagtgtccactgttctagatgagtag

DBGET integrated database retrieval system