KEGG   Mus musculus (mouse): 56613Help
Entry
56613             CDS       T01002                                 

Gene name
Rps6ka4, 1110069D02Rik, 90kDa, AI848992, Msk2, mMSK2
Definition
(RefSeq) ribosomal protein S6 kinase, polypeptide 4
  KO
K16510  ribosomal protein S6 kinase alpha-4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    56613 (Rps6ka4)
   04668 TNF signaling pathway
    56613 (Rps6ka4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    56613 (Rps6ka4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     56613 (Rps6ka4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   56613 (Rps6ka4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Pkinase_fungal Kdo RIO1 Pkinase_C Choline_kinase
Motif
Other DBs
NCBI-GeneID: 56613
NCBI-ProteinID: NP_064308
MGI: 1930076
Ensembl: ENSMUSG00000024952
UniProt: Q9Z2B9
Position
19; 19 A
AA seq 773 aa AA seqDB search
MGDEDEDEGCAVELQITEANLTGHEEKVSVENFALLKVLGTGAYGKVFLVRKTGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKAGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPLRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVKSHPF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPAGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMADVLQAPGAGYRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEENTQREVAALRLCQSHPNVVNLHEVLHDQLHTY
LVLELLRGGELLEHIRKKRLFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYAD
DTPGAPVKIIDFGFARLRPQSPAEPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILY
MMLSGQVPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPA
KRLKLEGLRSSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLK
SVENAPLAKRRKQKLRSAAASRRGSPVPASSGRLPASAAKGTTRRANGPLSPS
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgaggatgaggacgagggctgcgccgtggagctgcagatcaccgaagccaac
ctcaccgggcatgaggagaaggtgagcgtggagaacttcgcgctgctcaaggtgctgggc
acgggagcctatgggaaggtgttcctggtgcggaagacgggtgggcacgacgcgggcaag
ctctatgccatgaaggtgctacgcaaggcggcgttggtgcagcgcgcgaagacacaggag
catacccgcaccgaacgctcggtgctggagctggttcgccaagcacccttcctggtcaca
ctgcactacgccttccagacggatgccaagctgcacctcatcctggactacgtgagcggt
ggtgagatgttcactcacctctaccagcgccagtacttcaaggaggctgaggttcgagtg
tatgggggcgagattgtgctggccctggaacacctgcacaagctgggtatcatctaccgg
gacctgaagctggagaacgtcttacttgactcagaaggtcacatcgtccttacagacttt
gggctgagcaaggagttcctgacggaggagaaagagcggaccttctccttctgtggcaca
atcgagtacatggctcccgaaatcatccgaagcaaggctggacatggcaaggctgtggac
tggtggagcctgggtatcctgctcttcgagctgctgacaggggcctcacccttcacactg
gagggagagaggaacactcaggctgaggtgtcccgacggatcttgaagtgctcccctccc
ttccctctccggattgggcctgtggcacaggacctgctacagcggctgctgtgcaaggac
cctaagaagaggttgggcgcaggtccccagggtgcgcaggaagtcaagagtcaccccttc
ttccagggtctggactgggtggctctggctgccagaaagatcccagccccattccggccc
cagatccgctcagagctggatgtggggaattttgcggaggaattcacccggctggagccc
gtctactcccctgcaggcagccctccacctggggaccctcggatctttcagggatactcc
ttcgtggctccgtccatcctctttgaccacaacaatgcagtgatggctgatgtactgcag
gcaccgggtgccggatacaggcccggcagggcagcagttgccaggagtgccatgatgcag
gactcgcctttcttccagcagtacgaactggaccttcgggagccagcgctggggcagggc
agcttctctgtgtgtcggagatgtaggcagcgccagagcggccaggagtttgctgtcaag
atcctcagccgcaggctggaggagaacactcagcgagaggtggctgctcttcgcctgtgc
cagtcacaccccaacgtggtgaatctgcatgaggtgcttcatgaccagctacacacttac
ctggtcctggagttgctgcgaggcggagagctattggaacacatccgcaagaagcggctc
ttcagcgagtcggaggccagccagatccttcggagcctggtttcggccgtgagcttcatg
cacgaggaggcaggcgtggtgcaccgcgacctgaaacccgagaacatcttgtacgcggac
gacactcccggggccccggtgaagatcatcgacttcgggttcgcgcgactgcggccccag
agcccggcagagcccatgcagactccttgcttcacactgcagtacgctgcacccgagctg
ctggcacagcagggctacgatgagtcctgcgatctatggagcctgggtgtcattctgtac
atgatgctgtctggccaggttcccttccaaggggcctccggccagggtggacagagtcag
gcagctgagatcatgtgcaagatccgtgaagggcgcttctccctggacggggaagcctgg
caaggtgtgtcggaggaagccaaggagctggtccgagggctactgacagtcgaccccgcc
aagcggctgaagctggaggggctgcgtagcagctcgtggcttcaggacggcagcgcgcgc
tcctcgcccccgctccgcacgccggatgtgctggagtcctctgggccagctgtgcgttcc
gggctcaatgccactttcatggcgttcaaccgaggcaagcgcgagggcttctttctcaag
agtgtagagaatgcgcctctggccaagaggcgcaagcagaagctccggagcgcggccgcc
tcccgccgaggctccccagtgcctgcctcctccggtcgcctaccagcctctgccgctaag
gggacaactcgccgagccaacggccccttgtccccttcctag

DBGET integrated database retrieval system