KEGG   Mus musculus (mouse): 56620Help
Entry
56620             CDS       T01002                                 

Gene name
Clec4n, Clec6a, Clecsf10, Nkcl
Definition
(RefSeq) C-type lectin domain family 4, member n
  KO
K17514  C-type lectin domain family 6 member A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    56620 (Clec4n)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    56620 (Clec4n)
   04091 Lectins [BR:mmu04091]
    56620 (Clec4n)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   56620 (Clec4n)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    56620 (Clec4n)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C
Motif
Other DBs
NCBI-GeneID: 56620
NCBI-ProteinID: NP_064385
MGI: 1861231
Ensembl: ENSMUSG00000023349
Vega: OTTMUSG00000027044
UniProt: Q9JKF4 Q3V2N1
Position
6 F2; 6 58.3 cM
AA seq 209 aa AA seqDB search
MVQERQSQGKGVCWTLRLWSAAVISMLLLSTCFIASCVVTYQFIMDQPSRRLYELHTYHS
SLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTE
AEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIV
YWNPSKWGWNDVFCDSKHNSICEMKKIYL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggaaagacaatcccaagggaagggagtctgctggaccctgagactctggtca
gctgctgtgatttccatgttactcttgagtacctgtttcattgcgagctgtgtggtgact
taccaatttattatggaccagcccagtagaagactatatgaacttcacacataccattcc
agtctcacctgcttcagtgaagggactatggtgtcagaaaaaatgtggggatgctgccca
aatcactggaagtcatttggctccagctgctacctcatttctaccaaggagaacttctgg
agcaccagtgagcagaactgtgttcagatgggggctcatctggtggtgatcaatactgaa
gcggagcagaatttcatcacccagcagctgaatgagtcactttcttacttcctgggtctt
tcggatccacaaggtaatggcaaatggcaatggatcgatgatactcctttcagtcaaaat
gtcaggttctggcacccccatgaacccaatcttccagaagagcggtgtgtttcaatagtt
tactggaatccttcgaaatggggctggaatgatgttttctgtgatagtaaacacaattca
atatgtgaaatgaagaagatttacctatga

DBGET integrated database retrieval system