KEGG   Mus musculus (house mouse): 56626
Entry
56626             CDS       T01002                                 
Symbol
Poll, 1110003P06Rik, AV007317
Name
(RefSeq) polymerase (DNA directed), lambda
  KO
K03512  DNA polymerase lambda [EC:2.7.7.7 4.2.99.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03410  Base excision repair
mmu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    56626 (Poll)
   03450 Non-homologous end-joining
    56626 (Poll)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    56626 (Poll)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     56626 (Poll)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.-
     56626 (Poll)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     56626 (Poll)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     56626 (Poll)
SSDB
Motif
Pfam: DNA_pol_B_palm DNA_pol_B_thumb DNA_pol_lambd_f HHH_8 BRCT_2 HHH_5 NTP_transf_2 HHH BRCT LIG3_BRCT
Other DBs
NCBI-GeneID: 56626
NCBI-ProteinID: NP_001317435
MGI: 1889000
Ensembl: ENSMUSG00000025218
UniProt: Q9QXE2
Position
19:complement(45540714..45549025)
AA seq 573 aa
MDPQGIVKAFPKRKKSHADLSSKALAKIPKREVGEARGWLSSLRAHIMPAGIGRARAELF
EKQIIHHGGQVCSAQAPGVTHIVVDEDMDYERALRLLRLPQLPPGAQLVKSTWLSLCLQE
GRLTDTEGFSLPMPKRSLDEPQPSKSGQDASAPGTQRDLPRTTLSLSPPHTRAVSPPPTA
EKPSRTQAQLSSEDETSDGEGPQVSSADLQALITGHYPTPPEEDGGPDPAPEALDKWVCA
QPSSQKATNYNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVSSYQEACSI
PGIGKRMAEKVMEILESGHLRKLDHISDSVPVLELFSNIWGAGTKTAQMWYHQGFRNLED
LQSLGSLTAQQAIGLKHYDDFLDRMPREEAAEIEQTVRISAQAFNPGLLCVACGSYRRGK
MTCGDVDVLITHPDGRSHRGIFSCLLDSLRQQGFLTDDLVSQEENGQQQKYLGVCRLPGP
GKRHRRLDIIVVPYCEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSAAVVRNSQG
VKVGPGQVLPTPTEKDVFKHLGLPYREPAERDW
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggaccctcagggcatcgtgaaggcctttcccaagcggaagaaaagtcatgcagatcta
tcttcaaaagcacttgcaaagattcccaaaagggaggtgggagaagctagaggatggctg
agctccctgagagcccacattatgcccgctggcattggacgtgcccgggctgaactcttt
gagaagcagattatccaccatggcggccaggtgtgctctgcccaggccccaggagtcact
cacattgtggtggatgaagacatggactatgagcgggctctccggctcctcaggttgccc
cagctaccccctggtgcccagctggtgaagtccacctggctgagcttgtgcctgcaggag
ggaaggctgacagacacggaaggattcagccttcccatgcccaagaggtccttggatgaa
ccacagcccagcaagtcaggccaagatgcttctgctcctggcacccagcgggatttaccc
aggaccaccctttctctttcccctcctcacaccagagctgtatctcctcccccaacggca
gaaaagccatcaagaacccaagcccagctcagctcagaggatgaaaccagcgatggagaa
gggccccaggttagctcagcagatctgcaagccttgatcactgggcactaccccactccc
cctgaggaagatggtgggcctgacccagcaccagaagctctggataaatgggtctgtgca
cagccctcgagccagaaggcaactaactacaatctgcacatcacagagaagctggaagtg
ctggctaaagcctacagtgtccagggagacaagtggagggccctgggctatgcaaaggcc
atcaatgctctcaagagcttccacaagcctgtcagctcctaccaggaggcctgtagcatc
ccgggaattggcaagcggatggcggagaaggtcatggagatcctggagagtgggcatctg
cggaagctagaccacatcagtgacagtgtgcctgtcttggagctcttctccaacatctgg
ggagctgggacgaagactgcccagatgtggtaccatcagggcttccgaaacctagaagat
ctccaaagcctgggctccctgaccgctcagcaggccattggcttgaagcactacgatgac
ttcctggaccgcatgcccagggaggaggctgcggaaattgagcagacggtccggatatca
gcccaggccttcaaccctgggctgctgtgtgtggcttgtggctcttaccgacgggggaag
atgacgtgcggggatgtggatgtactcattactcaccccgatggccgatcccaccggggc
atcttcagctgcctccttgatagccttcggcagcaagggttcctcacagatgacttggtg
agccaggaggagaacggccaacagcagaaatacctgggtgtgtgccggctcccagggccc
gggaagcgccaccggcgactggacatcatcgtggtaccctactgtgagtttgcctgtgcc
ctgctctacttcaccggctctgcccacttcaaccggtccatgagagctctggccaagacc
aagggcatgagcctgtcggagcatgcgctcagtgcagctgtagtccggaacagccaaggt
gtcaaggtggggcctggacaagtgctgcccacccccacggagaaggacgtcttcaagcac
ttaggcctgccctaccgggagccagctgaacgggactggtga

DBGET integrated database retrieval system