KEGG   Mus musculus (mouse): 56632Help
Entry
56632             CDS       T01002                                 

Gene name
Sphk2, C76851
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04020  Calcium signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu05152  Tuberculosis
Module
mmu_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    56632 (Sphk2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    56632 (Sphk2)
   04371 Apelin signaling pathway
    56632 (Sphk2)
   04020 Calcium signaling pathway
    56632 (Sphk2)
   04072 Phospholipase D signaling pathway
    56632 (Sphk2)
   04071 Sphingolipid signaling pathway
    56632 (Sphk2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    56632 (Sphk2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    56632 (Sphk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     56632 (Sphk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 56632
NCBI-ProteinID: NP_001166032
MGI: 1861380
Ensembl: ENSMUSG00000057342
Vega: OTTMUSG00000023186
UniProt: Q9JIA7 Q58E38
Position
7; 7 B3
AA seq 617 aa AA seqDB search
MAPPPLLPVAASTPILHGEFGSYPANGPRFALTLTTQALHIQRLRPKPEARPRDGLVSLD
EVSGCGTLQSRSPEDTAAYFCIYTYPRGRRGGRRRATRTFRADGATTYEENRAEAQRWAT
ALTCLLRGVPLSGDQEITPELLPRKPRLLILVNPFGGRGLAWQRCMDHVVPMISEAGLSF
NLIQTERQNHARELVQGLSLSEWEGIVTVSGDGLLYEVLNGLLDRPDWEDAVRMPIGVLP
CGSGNALAGAVNHHGGFEQVVGVDLLLNCSLLLCRGGSHPLDLLSVTLASGSRCFSFLSV
AWGFLSDVDIHSERFRALGSARFTLGAVLGLASLHTYRGRLSYLPATTEPALPIPGHSLP
RAKSELVLAPAPAPAATHSPLHRSVSDLPLPLPQPALVSPGSPEPLPDLSLNGGGPELTG
DWGGAGDAPLSPDPLLPSSPNALKTAQLSPIAEGPPEMPASSGFLPPTHSAPEASTWGPV
DHLLPPLGSPLPQDWVTIEGEFVLMLGILPSHLCADLMAAPHARFDDGVVHLCWVRSGIS
RAALLRILLAMEHGNHFSLGCPHLGYAAARAFRLEPLTPRGLLTVDGELVEYGPIQAQVH
PGLATLLTGPAGQKPQA
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggccccaccaccactactgccagtggctgccagcactccaatcctgcacggcgagttt
ggttcctacccggccaacggcccacggtttgccctcaccctcacaacacaagccctacac
atacagcgactacgcccaaagccagaagcccggccccgagatggtctagtctctctggat
gaggtctcgggctgtggcaccctgcagagccgtagccccgaggacactgcagcctacttc
tgcatctacacctacccacgtggccgtcgagggggccggcgcagagctacgcggaccttc
cgggcggatggggccaccacttatgaggagaatcgtgcagaggcccagcgctgggccact
gccctcacgtgtctcctccgaggagtgcctctgtcaggggaccaggaaatcacccctgaa
ttgctgccccggaagcccaggctgctcatattggtcaatccctttggggggcggggcctg
gcctggcagcgctgtatggaccacgtggtgccaatgatctctgaagctgggctgtccttc
aacctcatacagacagaacgacagaaccatgcccgtgagctggtgcaggggttaagcctg
agtgagtgggaaggcattgtcactgtgtctggagacgggctgctttacgaggtgctgaat
gggctccttgatcggccagactgggaggatgccgtgcggatgcccattggtgtcctcccc
tgtggatcgggcaatgcgctagctggggcggtgaaccatcatggcgggtttgagcaggtt
gtcggtgttgacctgttgctcaactgctcgcttcttctctgccgtggtggcagccatcct
ctggacctgctctctgtgacgctagcctcgggatcccgctgtttttccttcctgtcagtg
gcctggggattcttgtcagatgtggacattcacagtgagcgcttcagggccctgggcagc
gctcgattcacactgggtgcagtgctaggcctggcctcgttgcatacctaccgtggacgc
ctctcctacctccccgctaccacagaaccagccttgcccatcccaggccacagtctgcct
cgagccaagtcagaactagtcttggctccagccccagcccccgccgccacccactcgcct
ctacatcgatctgtgtctgacctgcccctgccccttccccagcctgccttggtctcccct
ggctcccctgagcccctgcctgacctgtccctcaatggtggtggtccagagctgactgga
gactggggaggagctggggatgcacctctgtccccagacccactgctgccttcatccccc
aacgctctcaaaacagctcagctttcacccatcgctgaagggcccccagaaatgccagca
tcttcggggttcctgcctcccacccacagtgccccagaagcctctacctggggcccagtg
gaccacctcctccctcccctgggctctccactgccccaagactgggtgacaatagagggg
gagtttgtactcatgttgggcatcttgccgagccacctctgcgcagacctgatggcagcc
ccacatgcacgctttgatgatggcgttgtgcacctgtgttgggtgcggagcggcatctca
cgggctgcacttctacgcattttgctggccatggagcatggaaaccacttcagcctgggc
tgcccccatctgggctatgctgcagcacgtgccttccgccttgaaccactcacgcctcgt
ggcctgctcactgtagatggggagttagtggagtatgggccaatacaggcgcaggtgcac
ccaggtctcgccacgctgctcactgggcctgcaggtcaaaagccacaagcctga

DBGET integrated database retrieval system