KEGG   Mus musculus (mouse): 56637Help
Entry
56637             CDS       T01002                                 

Gene name
Gsk3b, 7330414F15Rik, 8430431H08Rik, C86142, GSK-3, GSK-3beta, GSK3
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04012  ErbB signaling pathway
mmu04062  Chemokine signaling pathway
mmu04110  Cell cycle
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04310  Wnt signaling pathway
mmu04340  Hedgehog signaling pathway
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04657  IL-17 signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04728  Dopaminergic synapse
mmu04910  Insulin signaling pathway
mmu04916  Melanogenesis
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04934  Cushing's syndrome
mmu05010  Alzheimer's disease
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Module
mmu_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    56637 (Gsk3b)
   04310 Wnt signaling pathway
    56637 (Gsk3b)
   04340 Hedgehog signaling pathway
    56637 (Gsk3b)
   04390 Hippo signaling pathway
    56637 (Gsk3b)
   04151 PI3K-Akt signaling pathway
    56637 (Gsk3b)
   04150 mTOR signaling pathway
    56637 (Gsk3b)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    56637 (Gsk3b)
  Cellular community - eukaryotes
   04510 Focal adhesion
    56637 (Gsk3b)
   04550 Signaling pathways regulating pluripotency of stem cells
    56637 (Gsk3b)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    56637 (Gsk3b)
   04657 IL-17 signaling pathway
    56637 (Gsk3b)
   04662 B cell receptor signaling pathway
    56637 (Gsk3b)
   04062 Chemokine signaling pathway
    56637 (Gsk3b)
  Endocrine system
   04910 Insulin signaling pathway
    56637 (Gsk3b)
   04917 Prolactin signaling pathway
    56637 (Gsk3b)
   04919 Thyroid hormone signaling pathway
    56637 (Gsk3b)
   04916 Melanogenesis
    56637 (Gsk3b)
  Nervous system
   04728 Dopaminergic synapse
    56637 (Gsk3b)
   04722 Neurotrophin signaling pathway
    56637 (Gsk3b)
  Development
   04360 Axon guidance
    56637 (Gsk3b)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    56637 (Gsk3b)
   05210 Colorectal cancer
    56637 (Gsk3b)
   05225 Hepatocellular carcinoma
    56637 (Gsk3b)
   05226 Gastric cancer
    56637 (Gsk3b)
   05217 Basal cell carcinoma
    56637 (Gsk3b)
   05215 Prostate cancer
    56637 (Gsk3b)
   05213 Endometrial cancer
    56637 (Gsk3b)
   05224 Breast cancer
    56637 (Gsk3b)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    56637 (Gsk3b)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    56637 (Gsk3b)
   04931 Insulin resistance
    56637 (Gsk3b)
   04934 Cushing's syndrome
    56637 (Gsk3b)
  Infectious diseases
   05166 HTLV-I infection
    56637 (Gsk3b)
   05162 Measles
    56637 (Gsk3b)
   05164 Influenza A
    56637 (Gsk3b)
   05160 Hepatitis C
    56637 (Gsk3b)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    56637 (Gsk3b)
   05169 Epstein-Barr virus infection
    56637 (Gsk3b)
   05165 Human papillomavirus infection
    56637 (Gsk3b)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    56637 (Gsk3b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     56637 (Gsk3b)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   56637 (Gsk3b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    56637 (Gsk3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo ABC1
Motif
Other DBs
NCBI-GeneID: 56637
NCBI-ProteinID: NP_062801
MGI: 1861437
Ensembl: ENSMUSG00000022812
Vega: OTTMUSG00000016276
UniProt: Q9WV60 Q5KU03
Structure
PDB: 

Position
16; 16 B3
AA seq 420 aa AA seqDB search
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggcgaccgagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggtagcatgaaagttagcagagataaagatggcagcaaggtaaccacagta
gtggcaactcctggccagggtcctgacaggccacaggaagtcagttatacagacacgaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattctggagaa
ctggttgccatcaagaaagttctacaggacaagcgatttaagaaccgagagctccagatc
atgagaaagctagaccactgtaacatagtccgactgcggtatttcttctactcgagtggt
gagaagaaagatgaggtctaccttaacctggtgctggactatgttccggagacagtgtac
agagtcgccagacactatagtcgagccaagcagacactccctgtgatctatgtcaagttg
tatatgtatcagctgttcagaagtctagcctatatccattcctttggaatctgccatcga
gacattaaaccacagaacctcttgttggatcctgatacagctgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagagcccaatgtttcatatatctgttctcgg
tactacagggcaccagagttgatctttggagccactgattacacgtccagtatagatgta
tggtctgcaggctgtgtgttggctgaattgttgctaggacaaccaatatttcctggggac
agtggtgtggatcagttggtggaaataataaaggtcctaggaacaccaacaagggagcaa
attagagaaatgaacccaaattatacagaattcaaattccctcaaatcaaggcacatcct
tggacaaaggtcttccggccccgaactccaccagaggcaattgcactgtgcagccgtctg
ctggagtacacacctaccgcccggctaacaccactggaagcttgtgcacattcatttttc
gatgaattgcgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aactttaccactcaagaactgtcaagtaacccccctctggccaccatccttatccctcca
catgctcggattcaggccgctgcttcaccgcctgccaacgccacagcagcctcagatact
aatgctggagaccgtggacagaccaataacgccgcttctgcatcagcttccaactccacc
tga

DBGET integrated database retrieval system