KEGG   Mus musculus (house mouse): 56643
Entry
56643             CDS       T01002                                 
Symbol
Slc15a1, D630032F02, PECT1, PEPT1
Name
(RefSeq) solute carrier family 15 (oligopeptide transporter), member 1
  KO
K14206  solute carrier family 15 (oligopeptide transporter), member 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    56643 (Slc15a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    56643 (Slc15a1)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC15: Proton oligopeptide cotransporter
   56643 (Slc15a1)
SSDB
Motif
Pfam: PTR2 MFS_2 DUF4397 AlgF
Other DBs
NCBI-GeneID: 56643
NCBI-ProteinID: NP_444309
MGI: 1861376
Ensembl: ENSMUSG00000025557
UniProt: Q9JIP7 Q14BA3 Q3UWE2
Structure
Position
14:complement(121697033..121742666)
AA seq 709 aa
MGMSKSRGCFGYPLSIFFIVVNEFCERFSYYGMRALLVLYFRNFLGWDDNLSTAIYHTFV
ALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVISVSSINDLTDHDHNGSPDSLPV
HVALSMVGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINGGSLLSTII
TPILRVQQCGIHSQQACYPLAFGVPAALMAVALIVFVLGSGMYKKFQPQGNIMGKVAKCI
GFAIKNRFRHRSKAYPKREHWLDWAKEKYDERLISQIKMVTKVMFLYIPLPMFWALFDQQ
GSRWTLQATTMNGKIGAIEIQPDQMQTVNAILIVIMVPIVDAVVYPLIAKCGFNFTSLKK
MTVGMFLASMAFVVAAIVQVEIDKTLPVFPGGNQVQIKVLNIGNNNMTVHFPGNSVTLAQ
MSQTDTFMTFDIDKLTSINISSSGSPGVTTVAHDFEQGHRHTLLVWNPSQYRVVKDGLNQ
KPEKGENGIRFVNTLNEMVTIKMSGKVYENVTSHNASGYQFFPSGEKQYTINTTAVAPTC
LTDFKSSNLDFGSAYTYVIRRASDGCLEVKEFEDIPPNTVNMALQIPQYFLLTCGEVVFS
VTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGHFPKQWAEYILFASLLLVV
CVIFAIMARFYTYINPAEIEAQFDEDEKKKGIGKENPYSSLEPVSQTNM
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggggatgtccaagtctcggggttgcttcggttacccgttgagcatcttcttcatcgtg
gtcaatgaattctgtgaaagattctcctactatggcatgcgagcactcctggttctgtac
ttcaggaacttcctcggctgggacgacaatctctccacggccatttaccatacgttcgtt
gccctctgctacctgactccaattcttggagctctgatcgcagactcgtggctggggaag
ttcaagacaattgtttcactatccatcgtctacacgattggacaagcagtcatctcggtg
agctcaattaatgacctcacagaccacgaccacaatggcagtcctgacagccttcccgtg
cacgtagcactgtccatggttggcctggccctgatagcccttggtacaggaggaatcaag
ccctgtgtgtctgcgtttggtggcgatcagtttgaagagggtcaggaaaaacagcgaaac
cggttcttttccatcttttatttggctatcaacgggggaagcctgctctccacgatcatc
actcccatactcagagttcaacagtgcggaatccacagtcaacaagcttgttacccactg
gccttcggggttccagcggctctcatggctgttgccctaattgtgtttgtccttggcagt
ggaatgtacaagaagttccagccccagggcaacatcatgggcaaagtggccaagtgcatt
ggttttgccatcaaaaacaggtttcggcaccgaagtaaggcatatcccaagagggagcac
tggctggactgggctaaagagaaatacgacgagcggctcatctcacagattaagatggtc
acgaaggtgatgttcctgtacatcccactccccatgttctgggccttgtttgaccagcag
ggttccagatggacactgcaagcaacgaccatgaatgggaaaattggagcaattgaaatt
cagccggaccagatgcagacggtgaatgccatcttgattgtcatcatggtccccattgtg
gacgctgtggtgtacccgctcattgcaaaatgtggtttcaacttcacatccctgaagaag
atgactgttgggatgttcctggcgtccatggcctttgtggtggctgcaattgtgcaggtg
gaaatcgataaaactcttccagtcttccctggtggaaatcaagtccaaattaaggtcttg
aacatcggaaacaataacatgaccgtgcattttcctggaaatagtgtgacgcttgcccaa
atgtctcagacagacacgttcatgactttcgatatagacaagctgacaagcataaacata
tcttcctctggatccccaggagtcaccacagtagctcatgattttgagcagggtcaccgg
cacacccttctagtgtggaaccccagtcaataccgtgtggtaaaagatggtcttaaccaa
aagccagagaaaggggagaacggaatcaggtttgtcaacacccttaacgagatggtcacc
atcaaaatgagtgggaaagtatatgaaaatgtcaccagtcacaacgccagcggctaccag
ttcttcccttctggcgaaaagcagtacacaataaacaccacggcggtggcaccaacctgt
ctaactgattttaaatcttccaaccttgactttggcagcgcgtatacctacgtgatccga
agggcgagtgatggctgcctggaagtgaaggaatttgaagacatcccacccaacactgtg
aacatggctctgcagatcccacagtacttccttctcacctgcggcgaggtggtcttctct
gtcacaggactggagttctcttattcccaggctccgtctaacatgaagtccgtgcttcag
gcaggctggcttctaactgtggcggtcggcaatatcattgtgctcatcgtggcaggggcg
gggcacttccccaaacagtgggctgagtacattctgtttgcctcattgcttctggttgtc
tgcgtgatattcgccatcatggctcgattctacacctacatcaacccagcagagattgaa
gcacagtttgatgaggatgagaagaaaaagggcataggaaaggaaaacccgtattcttca
ttggaaccagtctcacagacaaatatgtga

DBGET integrated database retrieval system