KEGG   Mus musculus (mouse): 56644
Entry
56644             CDS       T01002                                 

Gene name
Clec7a, BG, BGR, Clecsf, Clecsf12, beta-, beta-GR, dectin
Definition
(RefSeq) C-type lectin domain family 7, member a
  KO
K10074  C-type lectin domain family 7 member A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04613  Neutrophil extracellular trap formation
mmu04625  C-type lectin receptor signaling pathway
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    56644 (Clec7a)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    56644 (Clec7a)
   04625 C-type lectin receptor signaling pathway
    56644 (Clec7a)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    56644 (Clec7a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56644 (Clec7a)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    56644 (Clec7a)
   04090 CD molecules [BR:mmu04090]
    56644 (Clec7a)
   04091 Lectins [BR:mmu04091]
    56644 (Clec7a)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    56644 (Clec7a)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   56644 (Clec7a)
CD molecules [BR:mmu04090]
 Proteins
  56644 (Clec7a)
Lectins [BR:mmu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   56644 (Clec7a)
SSDB
Motif
Pfam: Lectin_C UL45 Ly49
Other DBs
NCBI-GeneID: 56644
NCBI-ProteinID: NP_001296566
MGI: 1861431
Ensembl: ENSMUSG00000079293
Vega: OTTMUSG00000042656
UniProt: V9GXI5
Structure
PDB: 
2BPD 2BPH 2BPE 2CL8

Position
6; 6 F3
AA seq 199 aa
MKYHSHIENLDEDGYTQLDFSTQDIHKRPRGSEKGSQAPSSPWRPIAVGLGILCFVVVVV
AAVLGALGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEF
IESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGS
EVYNQICNTSSYSICEKEL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaaatatcactctcatatagagaatctggatgaagatggatatactcaattagacttc
agcactcaagacatccataaaaggcccaggggatcagagaaaggaagccaggctccatct
tcaccttggaggcccattgcagtgggtttaggaatcctgtgctttgtggtagtagtggtt
gctgcagtgctgggtgccctaggaggtttttctcagccttgccttcctaattggatcatg
catgggaagagctgttacctatttagcttctcaggaaattcctggtatggaagtaagaga
cactgctcccagctaggtgctcatctactgaagatagacaactcaaaagaatttgagttc
attgaaagccaaacatcgtctcaccgtattaatgcattttggataggcctttcccgcaat
cagagtgaagggccatggttctgggaggatggatcagcattcttccccaactcgtttcaa
gtcagaaatacagctccccaggaaagcttactgcacaattgtgtatggattcatggatca
gaggtctacaaccaaatctgcaatacttcttcatacagtatctgtgagaaggaactgtaa

DBGET integrated database retrieval system