KEGG   Mus musculus (house mouse): 56690
Entry
56690             CDS       T01002                                 
Symbol
Mlycd, AI324784, Mcd
Name
(RefSeq) malonyl-CoA decarboxylase
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00410  beta-Alanine metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu04146  Peroxisome
mmu04152  AMPK signaling pathway
mmu04936  Alcoholic liver disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    56690 (Mlycd)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    56690 (Mlycd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    56690 (Mlycd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    56690 (Mlycd)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    56690 (Mlycd)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     56690 (Mlycd)
SSDB
Motif
Pfam: MCD MCD_N
Other DBs
NCBI-GeneID: 56690
NCBI-ProteinID: NP_064350
MGI: 1928485
Ensembl: ENSMUSG00000074064
UniProt: Q99J39
Position
8:120121591..120148577
AA seq 492 aa
MRGLGPGLRARRLLPLRSPPRPPGPRGRRLCGGLAASAMDELLRRAVPPTPAYELREKTP
APAEGQCADFVSFYGGLAEASQRAELLGRLAQGFGVDHGQVAEQSAGVLQLRQQAREAAV
LLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPHVREMNGV
LKSMLSEWFSSGFLNLERVTWHSPCEVLQKISECEAVHPVKNWMDMKRRVGPYRRCYFFS
HCSTPGEPLVVLHVALTGDISNNIQGIVKECPPTETEERNRIAAAIFYSISLTQQGLQGV
ELGTFLIKRVVKELQKEFPQLGAFSSLSPIPGFTKWLLGLLNVQGKEHGRNELFTDSECQ
EISAVTGNPVHESLKGFLSSGEWVKSEKLTQALQGPLMRLCAWYLYGEKHRGYALNPVAN
FHLQNGAVMWRINWMADSSLKGLTSSCGLMVNYRYYLEETGPNSISYLGSKNIKASEQIL
SLVAQFQNNSKL
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgcgaggcctcgggccaggcttgagggctcggcgcctgctcccactgcggtccccgccg
cggcctccggggccccggggacgtcggctgtgcggcgggctcgcggccagcgccatggac
gagctgctgcggcgagccgtgcccccgacgccggcctacgagctgcgcgagaagacgccg
gcgcccgccgagggccagtgcgccgacttcgtgagcttctacggcggcctggccgaggcg
tcccagcgcgccgagctgctcggccgcctggctcagggcttcggcgtggaccacggccag
gtggccgagcagagcgccggggtgctgcagctgcgccagcaggcgcgcgaggcggccgtg
ctgctgcaggcggaggaccggttgcgctacgcgctcgtgccgcggtatcgcggcctcttc
catcacatcagcaagctggacggcggcgtgcgcttcttggtgcagctgcgggccgatctg
ctggaggcgcaggccctcaagctggtggaggggccgcacgtccgggaaatgaacggagtg
ctcaaaagcatgctgtctgagtggttctcctccggcttcctgaacctggagcgggtcacc
tggcactcaccctgtgaggtacttcagaagatcagcgagtgtgaggctgtgcaccctgtg
aaaaactggatggacatgaagcggcgtgtggggccctaccggagatgttacttcttctcc
cactgctccacccccggggaacccctggtggttctgcatgtggctctgactggtgacatt
tccaacaacatccagggcattgtgaaggagtgccctccgactgaaaccgaggagaggaac
aggatcgccgctgccatcttctactccatcagcctgacccagcagggcctgcagggggtg
gagctcgggaccttcctcataaagagagtggtcaaggagctgcagaaggaatttcctcag
ctgggggccttttcaagcctgtcgcctatccctggattcaccaagtggctgctgggcctc
ctgaatgtgcaggggaaggagcatgggaggaacgaactattcacagactcagagtgccaa
gaaatctcagcggttaccggcaaccctgttcacgagagcctcaaggggttcctgagcagt
ggtgagtgggtgaagtcagagaagctgacgcaggcgctgcaggggccactaatgaggctg
tgtgcctggtacctgtacggtgagaagcaccgaggctacgccctcaacccagtggccaac
ttccatctgcagaatggggctgtgatgtggcgtatcaactggatggctgacagcagcctc
aaaggcctcaccagctcatgcggcctcatggtcaactaccgctactacctggaggagaca
ggccccaacagtatctcctacctgggctccaagaacatcaaagcttccgagcagatcctc
agcctggtagcccagttccagaacaacagcaaactctag

DBGET integrated database retrieval system