KEGG   Mus musculus (mouse): 56690
Entry
56690             CDS       T01002                                 

Gene name
Mlycd, AI324784, Mcd
Definition
(RefSeq) malonyl-CoA decarboxylase
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00410  beta-Alanine metabolism
mmu00640  Propanoate metabolism
mmu01100  Metabolic pathways
mmu04146  Peroxisome
mmu04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    56690 (Mlycd)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    56690 (Mlycd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    56690 (Mlycd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    56690 (Mlycd)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     56690 (Mlycd)
SSDB
Motif
Pfam: MCD MCD_N
Other DBs
NCBI-GeneID: 56690
NCBI-ProteinID: NP_064350
MGI: 1928485
Ensembl: ENSMUSG00000074064
Vega: OTTMUSG00000026334
UniProt: Q99J39
Position
8; 8 E1
AA seq 492 aa
MRGLGPGLRARRLLPLRSPPRPPGPRGRRLCGGLAASAMDELLRRAVPPTPAYELREKTP
APAEGQCADFVSFYGGLAEASQRAELLGRLAQGFGVDHGQVAEQSAGVLQLRQQAREAAV
LLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPHVREMNGV
LKSMLSEWFSSGFLNLERVTWHSPCEVLQKISECEAVHPVKNWMDMKRRVGPYRRCYFFS
HCSTPGEPLVVLHVALTGDISNNIQGIVKECPPTETEERNRIAAAIFYSISLTQQGLQGV
ELGTFLIKRVVKELQKEFPQLGAFSSLSPIPGFTKWLLGLLNVQGKEHGRNELFTDSECQ
EISAVTGNPVHESLKGFLSSGEWVKSEKLTQALQGPLMRLCAWYLYGEKHRGYALNPVAN
FHLQNGAVMWRINWMADSSLKGLTSSCGLMVNYRYYLEETGPNSISYLGSKNIKASEQIL
SLVAQFQNNSKL
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgcgaggcctcgggccaggcttgagggctcggcgcctgctcccactgcggtccccgccg
cggcctccggggccccggggacgtcggctgtgcggcgggctcgcggccagcgccatggac
gagctgctgcggcgagccgtgcccccgacgccggcctacgagctgcgcgagaagacgccg
gcgcccgccgagggccagtgcgccgacttcgtgagcttctacggcggcctggccgaggcg
tcccagcgcgccgagctgctcggccgcctggctcagggcttcggcgtggaccacggccag
gtggccgagcagagcgccggggtgctgcagctgcgccagcaggcgcgcgaggcggccgtg
ctgctgcaggcggaggaccggttgcgctacgcgctcgtgccgcggtatcgcggcctcttc
catcacatcagcaagctggacggcggcgtgcgcttcttggtgcagctgcgggccgatctg
ctggaggcgcaggccctcaagctggtggaggggccgcacgtccgggaaatgaacggagtg
ctcaaaagcatgctgtctgagtggttctcctccggcttcctgaacctggagcgggtcacc
tggcactcaccctgtgaggtacttcagaagatcagcgagtgtgaggctgtgcaccctgtg
aaaaactggatggacatgaagcggcgtgtggggccctaccggagatgttacttcttctcc
cactgctccacccccggggaacccctggtggttctgcatgtggctctgactggtgacatt
tccaacaacatccagggcattgtgaaggagtgccctccgactgaaaccgaggagaggaac
aggatcgccgctgccatcttctactccatcagcctgacccagcagggcctgcagggggtg
gagctcgggaccttcctcataaagagagtggtcaaggagctgcagaaggaatttcctcag
ctgggggccttttcaagcctgtcgcctatccctggattcaccaagtggctgctgggcctc
ctgaatgtgcaggggaaggagcatgggaggaacgaactattcacagactcagagtgccaa
gaaatctcagcggttaccggcaaccctgttcacgagagcctcaaggggttcctgagcagt
ggtgagtgggtgaagtcagagaagctgacgcaggcgctgcaggggccactaatgaggctg
tgtgcctggtacctgtacggtgagaagcaccgaggctacgccctcaacccagtggccaac
ttccatctgcagaatggggctgtgatgtggcgtatcaactggatggctgacagcagcctc
aaaggcctcaccagctcatgcggcctcatggtcaactaccgctactacctggaggagaca
ggccccaacagtatctcctacctgggctccaagaacatcaaagcttccgagcagatcctc
agcctggtagcccagttccagaacaacagcaaactctag

DBGET integrated database retrieval system