KEGG   Mus musculus (mouse): 56700
Entry
56700             CDS       T01002                                 

Symbol
Glmp, 0610031J06Rik, AB027141, NCU-G, NCU-G1
Name
(RefSeq) glycosylated lysosomal membrane protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: NCU-G1
Other DBs
NCBI-GeneID: 56700
NCBI-ProteinID: NP_064387
MGI: 1913318
Ensembl: ENSMUSG00000001418
Vega: OTTMUSG00000027147
UniProt: Q9JHJ3
Position
3; 3 F1
AA seq 404 aa
MFRCWGPHWGWVPCAPTPWLLLSLLVCSAPFGLQGEETRQVSMEVISGWPNPQNLLHIRA
VGSNSTLHYVWSSLGPPAVVLVATNTTQSVLSVNWSLLLSPDPAGALMVLPKSSIQFSSA
LVFTRLLEFDSTNASEGAQPPGKPYPPYSLAKFSWNNITNSLDLANLSADFQGRPVDDPT
GAFANGSLTFKVQAFSRSGRPAQPPRLLHTADVCQLEVALVGASPRGNHSLFGLEVATLG
QGPDCPSVNERNSIDDEYAPAVFQLNQLLWGSSPSGFMQWRPVAFSEEERARESALPCQA
STLHSTLASSLPHSPIVQAFFGSQNNFCAFNLTFGAPTGPGYWDQYYLCWSMLLGMGFPP
VDIFSPLVLGIMAVALGAPGLMFLGGGLFLLLRHRRYSEYQSIN
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtttcgctgttggggacctcactggggctgggtcccctgtgcccctaccccatggctc
cttttgagtctacttgtgtgttcagctccatttggcctgcagggagaagagactcgccag
gtatctatggaggttatttccggctggccaaatccacagaacctgcttcatattcgggca
gtgggcagcaactccaccctgcactatgtgtggagcagcctggggcctccagctgtggtg
ctggtggccactaacaccactcagagtgtcctgagtgtcaactggagtctcctgctgtct
cccgatcctgctggggccctgatggtgctccccaagagcagcatacagttttcttctgct
ctcgtcttcaccaggctgcttgagtttgacagcaccaatgcgtccgagggggcacagcct
ccaggaaagccataccctccgtactccttggccaagttctcctggaacaatatcaccaac
tcattggatcttgccaacctgagtgccgattttcaaggccgccctgtagatgatcctact
ggagcattcgccaatggcagcctgaccttcaaggtccaagccttttctagatctggtcga
cctgctcagccccctcgcctcctgcacacagcagatgtctgccagttagaagtggccctg
gttggagcttctcctcgtggaaaccattccctatttggtctagaggtagccaccttggga
cagggccctgactgcccctcagtgaacgaacggaactccatcgatgatgaatatgcacct
gccgtcttccagctgaaccagctgttatggggctcttctccatctggcttcatgcaatgg
cgaccagtggctttctctgaggaggagcgggcccgagaatcagccctcccctgccaggct
tccactcttcactccaccttggcatcttctctccctcattcaccaattgttcaagccttc
ttcgggtcccagaacaacttctgtgccttcaatctgacctttggggctcccacgggccct
ggctactgggaccaatactacctttgctggtcaatgcttctgggcatgggcttccctccg
gtggatatcttctctccactagtcctcggaatcatggcggtagccctgggagccccagga
ctcatgttcctggggggaggcctatttctgctgctgcgccacaggcggtattctgagtac
cagtccataaactga

DBGET integrated database retrieval system