KEGG   Mus musculus (mouse): 56702Help
Entry
56702             CDS       T01002                                 

Gene name
Hist1h1b, H1.5, H1B, H1f5, H1s-3
Definition
(RefSeq) histone cluster 1, H1b
  KO
K11275  histone H1/5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    56702 (Hist1h1b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    56702 (Hist1h1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Linker_histone
Motif
Other DBs
NCBI-GeneID: 56702
NCBI-ProteinID: NP_064418
MGI: 1861461
Ensembl: ENSMUSG00000058773
Vega: OTTMUSG00000000730
UniProt: P43276
Position
13; 13 A3.1
AA seq 223 aa AA seqDB search
MSETAPAETAAPAPVEKSPAKKKTTKKAGAAKRKATGPPVSELITKAVSASKERGGVSLP
ALKKALAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEAKPKA
KKTGAAKAKKPAGATPKKPKKTAGAKKTVKKTPKKAKKPAAAGVKKVAKSPKKAKAAAKP
KKAAKSPAKPKAVKSKASKPKVTKPKTAKPKAAKAKKAVSKKK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagactgctcccgctgagaccgcggctccggctcctgtagagaagtctcccgcc
aagaagaagacaacgaaaaaagctggcgcggcgaagcgcaaggccactggccccccggtg
tccgagctcatcactaaggctgtttctgcctctaaggagcgcggcggcgtgtccctgcct
gcccttaagaaggcactggctgctggtggctacgatgtggagaagaacaacagccgcatc
aagcttgggctcaagagtctggtgagcaagggtaccctggtgcagaccaagggcaccggc
gcctctggttccttcaagcttaacaagaaggcggcttctggcgaggccaagcccaaggct
aagaagaccggggctgccaaggccaagaagcctgcaggtgctacccctaaaaagcctaag
aagactgcgggggcaaagaagaccgtgaagaaaactccaaagaaagcgaagaagcctgcg
gcggctggagtgaagaaagttgccaagagtcctaagaaggccaaggctgctgccaagcct
aaaaaagcagcaaagagcccggccaagcccaaggcggtgaagtctaaggcatccaaacct
aaggttaccaagcctaagaccgctaagcctaaggctgccaaggccaagaaggctgtttcc
aaaaagaagtag

DBGET integrated database retrieval system