KEGG   Mus musculus (mouse): 56709Help
Entry
56709             CDS       T01002                                 

Gene name
Dnajb12, Dj10, mDj10
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B12
  KO
K09518  DnaJ homolog subfamily B member 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    56709 (Dnajb12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    56709 (Dnajb12)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP40 / DNAJ
   56709 (Dnajb12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1977 DnaJ TPR_2
Motif
Other DBs
NCBI-GeneID: 56709
NCBI-ProteinID: NP_001361685
MGI: 1931881
Ensembl: ENSMUSG00000020109
Vega: OTTMUSG00000034094
UniProt: Q9QYI4
Position
10; 10 B4
AA seq 378 aa AA seqDB search
MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSALIESLNQKPQSTGDH
PQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQVAAVKRVKQCKDYYEILGVSR
SASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQ
AARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQ
GDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSVGHIHKRVTDHLNVAYYVAD
TFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMG
TPSCNRLSETMKSLENFW
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggaatccaacaaggatgaagccgagcgctgtatcagcatcgccctcaaggccatccaa
agcaaccagcccgagcgggcgctgcgcttcctggagaaggcgcagcggctctacccgacg
ccacgagtcagcgcactgatcgagtccctcaaccaaaaaccacagtccaccggtgatcac
cctcaacccacagacactacccataccaccaccaagaaggcaggcgggaccgaaaccccc
tcagccaacggcgaggcaggaggaggggagagcgccaagggctatacctcagagcaggtg
gcagctgtgaaaagggtcaagcagtgtaaagattactatgagatccttggggtaagcaga
agtgcctcagatgaggacctaaagaaggcctaccgcaagctggccctcaagttccatcca
gacaagaaccatgcgcctggggccactgaagctttcaaagccattggcacagcgtatgcc
gtactcagcaacccagagaaaaggaaacagtacgaccagtttggtgatgacaagagccag
gctgcccggcacggccacagccacggggacttccaccgaggctttgaggctgacatctcc
ccagaagacctctttaacatgttctttggtggcggctttccttccagtaacgttcatgtc
tacagcaatggccgaatgcggtacacctaccagcagaggcaagaccgcagagacaaccag
ggtgatggcgggctaggagtgttcgtgcagctgatgcccatcctcatcctcatcctcgtg
tctgcgctcagccagctcatggtgtccagtcctccctacagcctgagcccgagaccgtca
gtgggccacatccacaagcgagtcactgaccacctgaacgtcgcctactacgtggcagac
accttctccgaagagtacacgggctccagcctcaaaacagtggaacggaatgtagaggat
gactacatcgccaacctgcgcaacaactgctggaaggagaagcagcagaaggaaggcttg
ctgtaccgagcccgctactttggtgacacagacatgtaccacagagcacagaagatgggc
accccgagttgcaatcggctgtcagagactatgaaatccctggagaatttttggtga

DBGET integrated database retrieval system