KEGG   Mus musculus (house mouse): 56711
Entry
56711             CDS       T01002                                 
Symbol
Plag1
Name
(RefSeq) pleiomorphic adenoma gene 1
  KO
K19484  zinc finger protein PLAG1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    56711 (Plag1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    56711 (Plag1)
SSDB
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-H2C2_2 zf-C2H2_jaz zf-met zf-C2H2_6 Acyltransf_C zf-C2H2_11 zf-H2C2_5
Other DBs
NCBI-GeneID: 56711
NCBI-ProteinID: NP_064353
MGI: 1891916
Ensembl: ENSMUSG00000003282
UniProt: Q9QYE0
Position
4:complement(3895209..3938429)
AA seq 499 aa
MATVIPGDLSEVRDTQKAPSGKRKRGESKPRKNFPCQLCDKAFNSVEKLKVHSFSHTGER
PYKCTHQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKET
FKCEECGKSYNTKLGFKRHLALHAATSGDLTCKVCLQNFESTGVLLEHLKSHAGKSSGGV
KEKKHQCEHCERRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQEL
LKVKTEPVDFLDPFTCNMSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQS
SGSAHQMITTLPLGMTCPIDMDAVHPSHHLAFKCPFSSTSYAISIPEKEQPLKGEIESYL
MELQGGAPSSSQDSPASSSKLGLEPQSGSPDDGAGDLSLSKSSISISDPLSTPALDFSQL
FNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPTQTQDLQDPANTVGLSSLHSLSAA
FTSSLSSSTTLPRFHQAFQ
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggccactgtcattcctggtgatttgtcagaagtaagagatacccagaaagccccttca
gggaaacgtaagcgtggtgaaagcaaaccaagaaaaaactttccttgccaactgtgtgac
aaggcctttaacagtgttgagaaattaaaggttcactccttctctcacacgggagagagg
ccctacaagtgcacacaccaagactgcaccaaggcctttgtttctaagtacaaattacaa
aggcacatggctactcactctcctgagaaaacccacaagtgtaattactgtgagaaaatg
tttcaccggaaagaccatctgaagaatcacctccatacacatgaccccaacaaagagacc
tttaaatgcgaagagtgtggcaagagctacaataccaagcttggttttaagcgacacttg
gccttgcatgctgccaccagtggtgacctcacctgcaaggtgtgtttgcagaattttgag
agcacaggtgtgctcctagagcacctgaaatctcacgcgggcaagtcatctgggggtgtg
aaggagaaaaagcaccaatgtgagcactgcgaacgcaggttctacacccggaaggatgtc
cggagacacatggtggtacacacaggaagaaaggacttcctctgtcagtactgcgcacag
agatttggacgaaaggatcacctcactcgacacatgaagaagagtcacaatcaggagctt
ctgaaggtcaaaacggaaccagtagatttcctggacccatttacctgcaacatgtctgtg
cctataaaagatgaactcctgccggtcatgtccttaccttccagtgaactcttgtcaaag
ccattcacaaacactttgcagttaaacctctataacactccatttcagtccatgcagagc
tctgggtctgctcaccaaatgataacaactttacctttgggaatgacatgccccatagat
atggatgctgttcacccctctcatcatcttgctttcaaatgcccattcagttctacctca
tacgcaatctctattcctgaaaaagaacagccattaaagggggaaattgagagttacctg
atggagctacaaggtggtgcaccatcttcatcccaggattctccagcatcgtcatctaag
ctagggttagagcctcagagtgggtcgccagatgatggtgctggggacctctccctgtca
aagagctctatctctatcagtgaccccctcagcacaccagcattggatttctctcagttg
ttcaatttcataccattgaatggtcccccttataacccactttcagtgggaagccttggg
atgagctattcccaggaggaagcacactcttctgtctctcagctgcccacacaaacacag
gatcttcaggaccctgcaaacactgtgggtctaagttctctgcactcactgtcggcagcg
ttcaccagcagcctgagctcaagcactaccttgccccgtttccaccaggcgtttcagtag

DBGET integrated database retrieval system