KEGG   Mus musculus (mouse): 56722
Entry
56722             CDS       T01002                                 

Gene name
Litaf, 3222402J11Rik, C85531, N4WBP3, TBX1
Definition
(RefSeq) LPS-induced TN factor
  KO
K19363  lipopolysaccharide-induced tumor necrosis factor-alpha factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    56722 (Litaf)
SSDB
Motif
Pfam: zf-LITAF-like
Other DBs
NCBI-GeneID: 56722
NCBI-ProteinID: NP_064364
MGI: 1929512
Ensembl: ENSMUSG00000022500
Vega: OTTMUSG00000026365
UniProt: Q9JLJ0
Position
16; 16 A1
AA seq 161 aa
MSAPGPYQAAAGPSVVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPS
YYTQPVPVPNANAIAVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCG
SLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKRL
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtcggctccaggaccttaccaagcagctgcaggcccttcagtagtgcccaccgcaccc
ccaacctatgaagaaacagtgggtgtcaacagttactacccaacgcccccagcacctatg
ccgggaccagccacagggctcattacaggcccagatgggaagggaatgaatccaccttcg
tactacacccagcctgtgcctgtccccaacgccaacgcaattgccgtgcagaccgtttat
gtgcagcagcctgtctccttctatgaccgccccgtccagatgtgctgtccttcctgcagc
aagatgatcgtgacccagctgtcctacaatgcgggagccctcacctggctctcctgtggc
agtctgtgtctgctgggatgcgttgctggctgctgcttcatcccgttctgcgtagacgcc
ctacaggatgtggaccactactgccccaactgcaaagcgctcctgggcacctacaagcgc
ttgtag

DBGET integrated database retrieval system