KEGG   Mus musculus (mouse): 56735
Entry
56735             CDS       T01002                                 

Symbol
Krt71, AA589543, Ca, Cal4, Cu, Krt2-6g, mK6irs, mK6irs1
Name
(RefSeq) keratin 71
  KO
K07605  type II keratin, basic
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    56735 (Krt71)
   04147 Exosome [BR:mmu04147]
    56735 (Krt71)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Types I and II: Acidic and basic keratins
     56735 (Krt71)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   56735 (Krt71)
  Exosomal proteins of other body fluids (saliva and urine)
   56735 (Krt71)
  Exosomal proteins of colorectal cancer cells
   56735 (Krt71)
  Exosomal proteins of bladder cancer cells
   56735 (Krt71)
SSDB
Motif
Pfam: Filament Keratin_2_head CENP-F_leu_zip TPR_MLP1_2 Baculo_PEP_C DUF5082 Alanine_zipper Crescentin Golgin_A5 ADIP
Other DBs
NCBI-GeneID: 56735
NCBI-ProteinID: NP_064340
MGI: 1861586
Ensembl: ENSMUSG00000051879
Vega: OTTMUSG00000027989
UniProt: Q9R0H5
Position
15:complement(101642384..101651532)
AA seq 524 aa
MSRQFTCKSGASNRGFSGCSAVLSGGSSSSYRAGGKGLSGGFGSRSLYSLGGGRSITLNM
ASGSGKNGGFGFGRNRASGFAGSIFGSVALGPVCPAVCPPGGIHQVTVNESLLAPLNVEL
DPEIQKVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLQTKWELLQQLDLNNCKNNLEP
ILEGHISNMRKQLETLSGDRVRLDSELRNVRDVVEDYKKKYEEEINRRTAAENEFVLLKK
DVDAAYANKVELQAKVDTMDQDIKFFKCLFEAEMAQIQSHISDMSVILSMDNNRNLDLDS
IIDEVRAQYEEIALKSKAEAEALYQTKFQELQLAAGRHGDDLKNTKNEITELTRFIQRLR
SEIENAKKQASNLETAIADAEQRGDSALKDARAKLDELEGALHQAKEELARMLREYQELM
SLKLALDMEIATYRKLLESEECRMSGEYSSPVSISIISSTSGSGGYGFRPSTVSGGYVAN
STSCISGVCSVRGGENRSRGSASDYKDTLTKGSSLSTPSKKGGR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgagccgccaattcacctgcaagtctggagccagcaacaggggcttcagtggttgctcc
gcagtgctctctgggggaagctcatcctcctaccgggcaggaggcaaagggctcagcggg
ggctttggcagtcggagtctctacagcctgggaggtggcaggagcatcactcttaacatg
gctagtggcagcgggaagaacggaggttttggatttggccggaaccgagccagtggcttt
gccggaagtatctttggcagtgtggccctggggcccgtgtgccctgctgtgtgcccgcct
ggcggtatccatcaggtcacagtcaatgaaagccttctggccccactcaatgtggagctg
gaccctgagatccagaaggtgcgcgcacaggagcgggagcagatcaaggctctgaacaac
aagtttgcctccttcattgacaaggtgcgcttcttggagcagcagaaccaggtgctgcag
accaagtgggagctgctgcagcagctggacctgaacaactgcaagaacaacctggaaccc
atccttgagggccacatcagcaacatgcggaagcagctggagacgctgtctggggacaga
gtgaggctggactctgagctgaggaatgtgcgtgacgtggtggaggactacaagaagaag
tatgaggaggagatcaaccggcggacagctgcagagaatgagtttgtgctgctgaagaag
gacgtggatgcggcttatgccaacaaggtggaactgcaggccaaggtggacaccatggac
caggacatcaaattcttcaagtgtctgttcgaagccgagatggctcagatccagtcccac
atcagcgacatgtccgtcatcctgtccatggacaacaacaggaacctggacctggacagc
atcatcgatgaggttcgcgctcagtatgaggagattgccctgaagagcaaggctgaagct
gaggccctgtaccagaccaagttccaggagctgcagctggcagctggtcgccatggagat
gacctcaaaaacaccaaaaatgaaatcactgagctgacccggttcatccagagactccgc
tcagagattgagaacgcaaagaagcaggcttctaacctagagacagccatcgctgatgcc
gagcagcgaggtgacagtgccctcaaggatgcccgggccaagctggatgagctggagggt
gccctgcaccaggccaaggaggagctggccaggatgctgcgtgaatatcaggagctcatg
agcctaaagttggccctggacatggagatcgccacctaccgcaaacttctggagagcgag
gagtgcaggatgtccggagaatactcttcccccgtcagcatctccattatcagcagcacc
agtggcagtggaggctatggcttccggcccagcacagtcagcggtggctacgtggccaat
agcactagctgcatctctggagtgtgcagtgtccgtggtggggagaacaggagcagaggt
agtgccagcgactacaaggataccctaacaaagggctccagtctgagcaccccctccaag
aaaggtggccgatga

DBGET integrated database retrieval system