KEGG   Mus musculus (house mouse): 56736
Entry
56736             CDS       T01002                                 
Symbol
Rnf14, 2310075C09Rik, 2610005D23Rik, AA986456, AU041447, D18Ertd188e, D7Bwg0165e, Triad2
Name
(RefSeq) ring finger protein 14
  KO
K11971  E3 ubiquitin-protein ligase RNF14 [EC:2.3.2.31]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    56736 (Rnf14)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     56736 (Rnf14)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    56736 (Rnf14)
SSDB
Motif
Pfam: RWD IBR zf-RING_5 zf-RING_2 zf-C3HC4 TBPIP
Other DBs
NCBI-GeneID: 56736
NCBI-ProteinID: NP_001158093
MGI: 1929668
Ensembl: ENSMUSG00000060450
UniProt: Q9JI90
Position
18:38410513..38450905
AA seq 485 aa
MSAEDLEAQEDELLALASIYDADEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNESLQN
SGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGR
VVLFAWMQFLKEETLTYLNIVSPFELKMGSQKKVQRRATAQASSSTELGVGGAAAADVDQ
EETVDERAVQDVESLSSLIQEILDFNQARQTKCFNSKLFLCSICFCEKLGSDCMYFLECK
HVYCKACLKDYFEIQIKDGQVKCLNCPEPQCPSVATPGQVKELVEADLFARYDRLLLQST
LDLMADVVYCPRPCCQLPVMQEPGGTMAICSSCNFAFCTLCRLTYHGLSPCKVTAEKLID
LRNEYLQADEATKRFLEQRYGKRVIQKALEEMESKDWLEKNSKSCPCCGTPIQKLDGCNK
MTCTGCMQYFCWICMGSLSRANPYRHFTDSESPCFNRLFHAVDINGDMWEDEIEEDDDDE
DDDDD
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgtcggcagaagacctggaagcccaggaggatgaactactggccctggcgagtatttat
gatgcggatgaatttagaaaagctgagtctgtccaaggaggagaaaccaggatctatttg
gatctgccacagaattttaagatattcgtgagcggcaattcaaatgagtctctccagaat
agtggctttgaatacaccatttgctttctgccaccacttgtgctgaactttgaactgcca
ccagattatccatcctcctccccaccttcattcacacttagtggcaaatggctgtcacca
actcagctctctgctctctgcaagcacctagacaacctgtgggaagaacaccgaggcaga
gtggtgctgtttgcctggatgcagtttcttaaggaggagaccctcacctacctgaatatt
gtctctccttttgagctcaagatggggtctcagaaaaaagttcagagaagggcaacagcc
caggcctcttccagcacagagcttggtgtgggaggagctgctgcggcggatgtagaccaa
gaagaaactgtggatgagagagctgtacaggatgtagagtcattgtcaagtctgatccag
gagatcttggacttcaatcaagctcggcagacgaagtgcttcaatagtaaactgttcttg
tgcagcatctgtttctgtgagaagctgggtagtgattgcatgtacttcttggagtgcaag
catgtatactgcaaagcctgtctgaaggattactttgaaatccagatcaaagatggtcaa
gttaaatgcctcaactgtccagagccacagtgcccttcagtggcgactcctggtcaggtc
aaagagctggtagaagcagacttgtttgctcgctatgaccgtctcctcctgcagtctacc
ttggatctaatggcagatgtggtgtattgtccccgtccatgctgccagctccctgtgatg
caagagcctggtggtaccatggctatctgctccagctgcaattttgccttctgtacctta
tgcagactgacctatcacgggctttctccatgtaaggtaactgcagagaaattaatagac
ttacgaaatgaatacctacaagcagatgaagctactaagaggttcttggaacagaggtat
ggcaagagggtgattcagaaggccctggaggagatggaaagtaaagactggctggagaag
aactccaagagctgcccctgctgtggcacacccatacagaaattagacggctgcaacaag
atgacttgcactggctgtatgcagtatttctgctggatttgcatgggttctctctctcga
gcaaatccttacagacatttcactgattctgagtctccatgctttaacaggttgttccat
gccgtggatattaatggtgatatgtgggaagatgaaattgaggaggacgacgatgatgaa
gacgacgacgacgactag

DBGET integrated database retrieval system