KEGG   Mus musculus (mouse): 56745
Entry
56745             CDS       T01002                                 

Symbol
C1qtnf1, 1600017K21Rik, Adip, CTR, CTRP1, Zsig37
Name
(RefSeq) C1q and tumor necrosis factor related protein 1
  KO
K19470  complement C1q tumor necrosis factor-related protein 1/6/8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    56745 (C1qtnf1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 C1q domain-containing proteins
  CBLN / gliacolin group proteins
   56745 (C1qtnf1)
SSDB
Motif
Pfam: C1q Collagen
Other DBs
NCBI-GeneID: 56745
NCBI-ProteinID: NP_001191058
MGI: 1919254
Ensembl: ENSMUSG00000017446
Vega: OTTMUSG00000003980
UniProt: Q9QXP7 A0A3B0J1J8
Position
11; 11 E2
AA seq 281 aa
MGSCAQGFMLGCCLLLAITWGPILSLVPRVQEEQQEWEETEELPSPLDPVTRPEETREKY
SPRQGEDLPTSRCYRCCDPSTPVYQTIPPPQINITILKGEKGDRGDRGLQGKYGKIGSTG
PRGHVGPKGQKGSIGAPGNHCKSQYAAFSVGRKKALHSNDYFQPVVFDTEFVNLYKHFNM
FTGKFYCYVPGIYFFSLNVHTWNQKETYLHIMKNEEEVVILYAQVSDRSIMQSQSLMMEL
REEDEVWVRLFKGERENAIFSDEFDTYITFSGYLVKPASEP
NT seq 846 nt   +upstreamnt  +downstreamnt
atgggctcctgtgcacagggattcatgctgggatgctgcctgctgctggccatcacctgg
ggccccatcctgagccttgtgccacgagttcaggaggaacaacaggagtgggaagagaca
gaggagctgccatctcctctggatcctgtgacaaggcctgaagaaacacgagagaagtat
agccctcgccagggtgaggacctccccacttctcggtgctaccgatgctgtgaccccagc
acacctgtataccagacaattcctccaccccagatcaacatcaccatcctgaaaggcgag
aaaggtgaccgaggggatcgaggcctccaggggaagtacggcaaaataggttctacaggt
cccaggggccatgttggccccaaagggcagaagggatccattggagcccctgggaaccac
tgcaagagccagtacgcagccttctccgtgggccggaagaaggctttgcacagcaacgac
tacttccagcccgtggtcttcgacacggagtttgtgaacctctacaaacacttcaatatg
ttcactgggaagttctactgctatgtgccgggcatctacttcttcagcctcaacgtgcac
acttggaaccagaaggagacgtacctgcacatcatgaagaacgaggaggaggtggtgatc
ctgtatgcgcaggtgagcgaccgcagcatcatgcagagtcagagcctgatgatggagctg
cgggaggaggatgaggtctgggtgcgtctcttcaagggcgagcgtgagaacgccattttc
agtgacgagttcgacacctacatcaccttcagtggctacctggtcaagccagcctctgag
ccctag

DBGET integrated database retrieval system