KEGG   Mus musculus (mouse): 56749
Entry
56749             CDS       T01002                                 

Gene name
Dhodh, 2810417D19Rik, AI834883
Definition
(RefSeq) dihydroorotate dehydrogenase
  KO
K00254  dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00240  Pyrimidine metabolism
mmu01100  Metabolic pathways
Module
mmu_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    56749 (Dhodh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     56749 (Dhodh)
SSDB
Motif
Pfam: DHO_dh FMN_dh Trp_syntA
Other DBs
NCBI-GeneID: 56749
NCBI-ProteinID: NP_064430
MGI: 1928378
Ensembl: ENSMUSG00000031730
Vega: OTTMUSG00000032870
UniProt: O35435
Position
8; 8 D3
AA seq 395 aa
MAWRQLRKRALDAAIILGGGGLLFTSYLTATGDDHFYAEYLMPALQRLLDPESAHRLAVR
VISLGLLPRATFQDSNMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKLGFGFVEVGSV
TPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSAVEHRLRARQQKQTQLTTDGLPLGIN
LGKNKTSVDAAADYVEGVRILGPLADYLVVNVSSPNTAGLRSLQGKTELRRLLSKVLQER
DALKGPQKPAVLVKIAPDLTAQDKEDIASVARELGIDGLIITNTTVSRPVGLQGALRSET
GGLSGKPLRDLSTQTIREMYALTQGTIPIIGVGGVSSGQDALEKIQAGASLVQLYTALTF
LGPPVVARVKRELEALLKERGFNTVTDAIGVDHRR
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggcgtggagacagctgagaaagcgggccctggatgcagccatcatccttgggggtgga
ggacttctcttcacctcttacctgacagccacgggggacgaccatttctacgccgagtac
ctgatgccggctctgcagagactgcttgatccagagtcggcgcaccggctagctgttcga
gtcatctccctggggctccttcctcgagctacgtttcaggactccaacatgctggaagtg
agagtcctgggccataaattccgaaatccagtagggattgctgcaggatttgacaagcac
ggggaagctgtggacggactctataagctgggctttggttttgttgaggtgggaagtgtg
actccccagcctcaggaaggaaaccccaggccccgagtattccgtctccctgaggaccaa
gctgttattaacaggtatggattcaacagccacgggctctcagcggtggaacacaggcta
cgggccagacagcagaagcagacccagctcaccacagatgggctgcctctgggaataaac
ctggggaagaataagacttcggtggatgctgctgcagactatgtagagggtgttcgcatc
ctgggccccttggccgactacctggtggttaacgtgtccagtcccaacactgctggcctg
aggagcctacagggaaagactgagctgcgccgcctgctgtccaaggtgctgcaggagagg
gacgccttgaagggacctcagaagccagcggtgctggtgaagattgcccctgacctcacg
gcccaggacaaggaggacattgccagcgtggccagagagctgggcatcgacggactgatc
atcacaaataccacagtgagtcgccctgttggcctccagggtgctctgcgctctgagaca
gggggactgagtgggaagccactccgagatctgtcgacccagacgatccgggagatgtac
gccctcacccaaggcacgattcccatcatcggggttggtggtgtgagcagcggacaggat
gccttggagaagatccaggcaggggcctccctggtgcagctgtacacggccctcaccttc
ttggggccaccagtcgtggccagggtcaagcgtgagctggaggcccttctaaaagaacgg
ggttttaacacagtgacagacgccattggagtagatcaccgcaggtga

DBGET integrated database retrieval system