KEGG   Mus musculus (mouse): 56752Help
Entry
56752             CDS       T01002                                 

Gene name
Aldh9a1, AA139417, Abaldh, ESTM40, TMABA-DH, Tmabadh
Definition
(RefSeq) aldehyde dehydrogenase 9, subfamily A1
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00053  Ascorbate and aldarate metabolism
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00561  Glycerolipid metabolism
mmu00620  Pyruvate metabolism
mmu01100  Metabolic pathways
Module
mmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    56752 (Aldh9a1)
   00053 Ascorbate and aldarate metabolism
    56752 (Aldh9a1)
   00620 Pyruvate metabolism
    56752 (Aldh9a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    56752 (Aldh9a1)
   00561 Glycerolipid metabolism
    56752 (Aldh9a1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    56752 (Aldh9a1)
   00310 Lysine degradation
    56752 (Aldh9a1)
   00330 Arginine and proline metabolism
    56752 (Aldh9a1)
   00340 Histidine metabolism
    56752 (Aldh9a1)
   00380 Tryptophan metabolism
    56752 (Aldh9a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    56752 (Aldh9a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     56752 (Aldh9a1)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     56752 (Aldh9a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 56752
NCBI-ProteinID: NP_064377
MGI: 1861622
Ensembl: ENSMUSG00000026687
Vega: OTTMUSG00000050636
UniProt: Q9JLJ2 Q3U367 Q3TMT4 Q3V1N7
Position
1; 1 H2.3
AA seq 518 aa AA seqDB search
MILGAVGSVLTSLLRIHRAAAVAAMSTGTFVVSQPLNYRGGARVEPVDASGTEKAFEPAT
GRVIATFACSGEKEVNLAVENAKAAFKLWSKKSGLERCQVLLEAARIIKERKDEIATVET
INNGKSIFEARLDVDTCWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIACWKSAPALACGNAMIFKPSPFTPVSALLLAEIYTKAGAPPGLFNVVQGGAATG
QFLCHHREVAKISFTGSVPTGVKIMEMSAKGVKPITLELGGKSPLIIFSDCNMENAVKGA
LMANFLTQGQVCCNGTRVFVQKEIADKFINEVVKQTQKIKLGDPLLEDTRMGPLINAPHL
ERVLGFVKLAKEQGATVLCGGEVYVPEDPKLKHGYYMTPCILTNCRDDMTCVKEEIFGPV
MSILTFGTEAEVLERANDTTFGLAAGVFTRDIQRAHRVAAELQAGTCYINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcggtgcagtcggttctgtgctgacctcgctcctccgcattcaccgggctgca
gcagtcgccgccatgagtactggcaccttcgtcgtgtcgcagccgctcaactaccgcggc
ggggcccgtgtggagccggtggatgcttccggcacggagaaagcgttcgagccagccacc
ggccgagtgattgccactttcgcgtgttcaggagaaaaggaagtaaacttggccgttgag
aatgcaaaggctgcctttaaactctggagtaagaaaagtggcctggagcgctgccaagtc
ctcctagaggctgcccggatcatcaaggagcggaaggatgaaattgccaccgtggagacc
atcaacaacgggaagtccatatttgaggcccgcctggatgttgacacttgctggcagtgc
ctggaatactatgcagggctggctgcatccatggcaggcgagcacattcagctcccagga
gggtccttcggctacacccgaagagagccgcttggggtgtgtgtggggataggagcatgg
aactatcccttccagatcgcctgttggaagtctgctccggctctggcttgtggtaatgcc
atgatctttaagccttctcccttcacgcctgtgtctgctctgctcctggctgagatctac
accaaagcgggtgcgcctccggggctcttcaacgtggtgcaaggtggggctgccacaggc
cagtttctgtgtcatcatcgcgaggtggccaaaatctccttcaccggaagtgtgcccact
ggcgtgaagatcatggagatgtccgctaagggagtcaagcccattactttggaacttggg
ggcaaatctcctctcatcatcttctcagactgtaatatggagaatgctgtgaagggggcc
ctgatggccaacttcctcacacaaggacaggtctgctgcaatgggactagagtctttgtg
caaaaggaaattgctgataaattcataaatgaggttgtgaagcagactcagaagataaaa
cttggagacccccttctggaagatacgaggatgggcccactcatcaacgccccacatctg
gaacgagtcctcgggtttgtcaagttggcaaaggagcagggtgctactgtgctgtgtggt
ggagaggtgtatgtaccagaggaccccaaattaaaacatggatattacatgacaccttgc
attttaactaattgcagagacgacatgacttgtgtaaaagaagagatctttggaccagtc
atgtccattttaacatttggaactgaagccgaggttctagagcgagctaatgacaccact
tttggactagcagctggggtcttcaccagggacatccagagggcacaccgggtggcggct
gagctgcaggctggaacgtgctacattaacaactataatgtcagcccagtggagctgccc
tttggtggctacaagaagtcaggatttggcagagagaatggccgtgtgacgattgagtac
tactctcagctgaagacggtgtgtgtggagatgggcgacgtggagtcagccttttga

DBGET integrated database retrieval system