KEGG   Mus musculus (mouse): 56771
Entry
56771             CDS       T01002                                 

Symbol
Med20, 1110011O05Rik, 2410115I17Rik, AU018348, Trfp
Name
(RefSeq) mediator complex subunit 20
  KO
K13528  mediator of RNA polymerase II transcription subunit 20
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    56771 (Med20)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Head
     56771 (Med20)
SSDB
Motif
Pfam: Med20
Other DBs
NCBI-GeneID: 56771
NCBI-ProteinID: NP_064432
MGI: 1929648
Ensembl: ENSMUSG00000092558
Vega: OTTMUSG00000037165
UniProt: Q9R0X0
Position
17; 17 C
AA seq 212 aa
MGVTCVSQMPVAEGKSLQQTVELLTKKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQAG
KLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYC
DFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHAPGAPTVFGNRH
DAVYGPADTMIQYMELFNKIRKQQQVPVAGIR
NT seq 639 nt   +upstreamnt  +downstreamnt
atgggagtgacgtgtgtgtcccagatgcctgtggctgagggcaagagtctccagcagaca
gtggagctcctcaccaagaaactggagatgcttggagcagagaaacaagggacattttgt
gtggactgtgagacttaccacacagctgcctctaccctgggcagccaaggccaggctggg
aagctgatgtacgtgatgcataactctgagtacccactgagctgctttgccctctttgag
aatggcccttgcctcattgctgacaccaacttcgatgtgcttatggtgaagctcaagggc
ttcttccagagtgccaaggccagcaagattgagacccggggcactcgctaccagtattgt
gacttcctggtgaaggtgggcacggtcacaatggggcccagtgcccgtggcatctctgtg
gaggtggagtatggcccttgtgtggtggctagtgactgctggagcctcctgcttgagttc
ctacagagttttctagggagccacgcaccaggggcacccacagtatttgggaacagacac
gatgcggtctatgggccagcagataccatgatacagtacatggaactcttcaacaagatc
cgaaaacagcagcaagtgccagtggctgggatccgttag

DBGET integrated database retrieval system