KEGG   Mus musculus (mouse): 56790Help
Entry
56790             CDS       T01002                                 

Gene name
Supt20, AA667204, AI450544, D3Ertd300e, Fam48a, Supt20h, p38IP
Definition
(RefSeq) suppressor of Ty 20
  KO
K21245  transcription factor SPT20 homolog
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    56790 (Supt20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    56790 (Supt20)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     56790 (Supt20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spt20
Motif
Other DBs
NCBI-GeneID: 56790
NCBI-ProteinID: NP_064379
MGI: 1929651
Ensembl: ENSMUSG00000027751
Vega: OTTMUSG00000053973
UniProt: Q7TT00
Position
3; 3 C
AA seq 531 aa AA seqDB search
MQQAVEQALDCAEYIVESAQQRPPKRKYLSSGRKSIFQKLYDLYVEECEKEPEVKQKLRR
NVNLLEKLVMQETLSCLVVNLYPGNEGYSLMLRGKNGSDSETIRLPYEEGELLEYLDAEE
LPPILVDLLEKSQVNIFHCGCVIAEIRDYRQSSNMKSPGYQSRHILLRPTMQTLVCDVHS
ITSDNHKWTQEDKLLLESQLILATAEPLCLDPSVAVACTANRLLYNRQKMNTRPMKRCWK
RYSRSSLNRQQDLSHGPPPPQLRLLDFLQKRKERKAGQHYDLKISKAGNCVDMWKRSPCN
LAVPSEVDVEKYAKVEESIKSDDSQPTMWPAHDVKDDYVFECEGGNQYQKTKLTILQSLG
DPLYYGKIQPWKADEENDSQMSPSHSSADDHSNWFVIGSKTDAERVVNQYQELVQNEAKC
PVKMSHSSSGSAALSPGEEAEQAETSSIQSSVLGKGVKHRPPPIKLPSGSGNSSSGNYFT
AQQASSFLKSPTPPPSCKPSLSRKSSVDLSQVSMLSPAALSPASSSQRHES
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagctgtagaacaagctttggattgcgcagagtacatcgtggaaagtgctcag
cagagacctcctaaaaggaaatacctgtctagtggaagaaagtctatatttcaaaaactt
tatgacttatatgttgaagaatgtgaaaaagaacccgaggttaagcagaaattaagaaga
aatgtgaacttgttagagaagcttgttatgcaggagactttgtcgtgtttagtagtcaat
ctgtacccaggaaatgaaggctattctctgatgctcagggggaaaaatggatcagattct
gagaccatccgattgccttatgaagaaggagaattgcttgaatacttagatgcagaagaa
ttacctcctattttggtggatctccttgaaaaatcacaggttaatatttttcattgtgga
tgtgtgatagcagaaatacgtgactataggcagtccagtaatatgaagtctcctggttac
caaagtaggcacattctcttacgtccaacaatgcagactttagtctgtgatgtccattct
ataacaagtgacaaccataagtggacccaggaagacaaacttttgcttgagagccagctg
attctagctacagcagagccactgtgtcttgacccatcggtggcagtagcgtgcactgcc
aataggctgctctataaccggcagaagatgaacactcgcccaatgaaacggtgttggaag
aggtactccaggtcctccctgaaccgccagcaggacctctctcacggccctcctccccct
cagctgagactacttgatttcttacaaaagcggaaggaaaggaaagcaggccagcattat
gacctcaaaatttccaaagcaggaaattgtgtagacatgtggaaacggagcccctgtaac
ttggctgtgccttctgaagtagatgtggaaaaatatgctaaagtggaggaatccatcaaa
tctgacgactcacagccaacaatgtggccagctcatgatgtaaaagacgattatgtattt
gaatgtgaaggtggtaatcagtatcagaaaacaaagctgaccatcttgcagtctcttggg
gatccactttactatggtaaaatacagccgtggaaagcagatgaagaaaatgacagccaa
atgtctccatcccactcctctgctgatgaccattcaaactggtttgtcattgggtcaaag
actgacgcagagagggtagttaatcaataccaggagttggtccagaatgaagccaaatgc
ccagtgaagatgtcacacagcagtagtggttcagccgctctcagtccaggggaggaggca
gaacaggcggagacctcgtccattcagtcttcagttttgggaaagggagtaaaacaccga
cccccacccatcaaacttccctcaggctcaggaaatagttcctcaggtaactatttcaca
gcacagcaggccagcagcttccttaaatctccaactcctcctccatcgtgtaagccaagc
ctttctcggaagtcttctgtggacctcagtcaagttagcatgctttctcctgccgccctg
tcccctgccagctcatcccagagacatgaaagctaa

DBGET integrated database retrieval system