KEGG   Mus musculus (mouse): 56795
Entry
56795             CDS       T01002                                 

Gene name
Arl10, Arl10a, Arm1
Definition
(RefSeq) ADP-ribosylation factor-like 10
  KO
K07958  ADP-ribosylation factor-like protein 10
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    56795 (Arl10)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Others
    56795 (Arl10)
SSDB
Motif
Pfam: Arf G-alpha SRPRB Roc MMR_HSR1 Ras ABC_tran AAA_22 Gtr1_RagA FtsK_SpoIIIE AAA_33 NACHT AAA_29 AAA_16
Other DBs
NCBI-GeneID: 56795
NCBI-ProteinID: NP_064352
MGI: 1930788
Ensembl: ENSMUSG00000025870
Vega: OTTMUSG00000032683
UniProt: Q9QXJ4
Position
13; 13 B1
AA seq 243 aa
MAPRPLGPLVLALGGAAAVLGSVLFILWKAYFGRGRERRWDRGEAWWGADTARLPQWDEW
EPEDEEDEPALEELEQREVLVLGLDGSGKSTFLRMLAGKPPVEGHVPTWGFNSVRLPTKN
FEVDLLEIGGSQNLRFYWKEFVNEVDVLVFMVDSTDRLRLPWARQELQKLLDRDPDLPVV
IVANKQDLSGAMNMVELQQELGLLASYNQREVFLLAASIAPAGSGFGEPGTVHIWKLLLQ
LLS
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcgccgcggccgctgggccccttggtgctggctctgggtggcgccgcagccgtgctg
ggctctgtgctctttatcctctggaaagcttacttcggccgcggccgggagcggcgctgg
gaccggggcgaggcctggtggggcgcggacactgcccgcctccctcagtgggacgagtgg
gagcccgaggacgaggaagatgagccggccttggaagagctggagcagcgggaagtgttg
gtgctgggcttggatggctcagggaaaagcacgttcttgcgcatgctggccgggaagcca
ccggtggaaggccacgtccctacctggggcttcaactctgttcggctgcctaccaagaat
ttcgaggtggacctgttagagattggtggcagccagaacctgcgcttttactggaaggag
tttgtcaacgaggtggacgtgctggtgttcatggtggactcgactgaccggctaaggctg
ccctgggctcggcaggagctgcagaaactgttggacagggatccggatctgcctgttgtt
atagtggccaacaagcaggacctgagcggggccatgaatatggtggagctgcagcaggag
ctgggcctccttgctagttataaccagagggaggttttcctcttggcagccagcattgcc
cctgcaggatctggctttggggaacccggcactgtgcacatctggaaattgctcttgcag
cttctctcctaa

DBGET integrated database retrieval system