KEGG   Mus musculus (mouse): 56807
Entry
56807             CDS       T01002                                 

Gene name
Scamp5, Sc5
Definition
(RefSeq) secretory carrier membrane protein 5
  KO
K19995  secretory carrier-associated membrane protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    56807 (Scamp5)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Others
   Others
    56807 (Scamp5)
SSDB
Motif
Pfam: SCAMP
Other DBs
NCBI-GeneID: 56807
NCBI-ProteinID: NP_001288563
MGI: 1928948
Ensembl: ENSMUSG00000040722
Vega: OTTMUSG00000063177
UniProt: Q9JKD3
Position
9; 9 B
AA seq 235 aa
MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHLSLTKRLYYLWMLNSVTLAVNLVGCLA
WLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISI
IQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVVAVFSFIALSMVHKFYRGSG
GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM
NT seq 708 nt   +upstreamnt  +downstreamnt
atggcggagaaagtgaacaacttcccaccattgcccaaattcatcccactgaagccatgt
ttctaccaagacttcgaggcagacatccctcctcagcatctcagcttgaccaagcgcctc
tactacctctggatgttgaacagcgtcacgctggccgtgaacctggtgggctgtctcgcg
tggctgatcggaggcgggggagccaccaactttggcctggcctttctctggctcatcctc
ttcacaccttgctcctacgtctgctggtttcggcccatttacaaggccttcaagacagac
agttccttcagcttcatggcattcttcttcaccttcatggctcagctggtcatcagcatc
atccaggctgtgggaattccaggctggggtgtctgcggctggattgccaccatttccttc
ttcgggacgaacatcggctcagcagtggtgatgctcattcccacggtcatgttcacagtt
gtggccgtcttttccttcattgctcttagcatggttcataagttctaccggggtagcgga
ggcagtttcagcaaggctcaggaggaatggaccactggagcgtggaagaacccacatgtg
cagcaggcagcccagaatgcagccatgggggctgctcagggtgccatgaatcaaccgcag
actcagtattctgccactcccaactacacgtactccaatgagatgtga

DBGET integrated database retrieval system