KEGG   Mus musculus (mouse): 56808
Entry
56808             CDS       T01002                                 

Gene name
Cacna2d2, Cacna2d, a2d, a2d2, du, mKIAA0558, td, torpid
Definition
(RefSeq) calcium channel, voltage-dependent, alpha 2/delta subunit 2
  KO
K04859  voltage-dependent calcium channel alpha-2/delta-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04921  Oxytocin signaling pathway
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    56808 (Cacna2d2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    56808 (Cacna2d2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    56808 (Cacna2d2)
   04261 Adrenergic signaling in cardiomyocytes
    56808 (Cacna2d2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    56808 (Cacna2d2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    56808 (Cacna2d2)
   05414 Dilated cardiomyopathy
    56808 (Cacna2d2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    56808 (Cacna2d2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   56808 (Cacna2d2)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 VWA_2 dCache_1 dCache_2 VWA_CoxE DUF5610 Ntox50
Other DBs
NCBI-GeneID: 56808
NCBI-ProteinID: NP_064659
MGI: 1929813
Ensembl: ENSMUSG00000010066
Vega: OTTMUSG00000036844
UniProt: Q6PHS9 A0A411ACX9
Position
9 F1; 9 58.02 cM
AA seq 1154 aa
MAVPARTCGASWPGPVRTARPWPGRGPRPCPDPRGPASGPARPLLLLLPPLLLLPLLTAP
GASAYSFPQQHTMQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVE
KVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIMYYDAKADAELDDPESED
MERGSKTSALRLDFIEDPNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFIE
NRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVD
VSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFK
EAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWP
NRTVRVFTFSVGQHNYDVTPLQWMACTNKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAG
KDAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRL
TPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMI
DGDKGHKQIRTLVKSLDERYIDEVIRNYTWVPIRSTNYSLGLVLPPYSTYYLQANLSDQI
LQVKLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTP
DSKQCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAED
WTENPEPFNASFYRRSLDNHGYIFKPPHQDSLLRPLELENDTVGVLVSTAVELSLGRRTL
RPAVVGVKLDLEAWAEKFKVLASNRTHQDQPQKCGPSSHCEMDCEVNNEDLLCVLIDDGG
FLVLSNQNHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPR
GVFVPTIADFLNLAWWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGSPETRESSCVMKQ
TQYYFGSVNASYNAIIDCGNCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHS
DGPEQCELVQRPRYRRGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPR
PQPQVHSFAASRHL
NT seq 3465 nt   +upstreamnt  +downstreamnt
atggcggtgccggctcggacctgcggcgcttcttggcccggcccggtgcggaccgctcgc
ccctggcccggtcgcggcccccggccctgccctgacccccggggcccagcgtccgggccc
gcacgcccgctcttgctcttgctgccgcctctgttgcttttaccgctgctcaccgccccc
ggcgcctctgcctacagcttcccccagcagcacacgatgcagcactgggcccggcgcctg
gagcaggagattgacggtgtgatgcggatttttggaggcgtgcagcagctccgagagatc
tacaaggacaatcggaacctgtttgaagtgcaggagaatgaaccacagaaattggtggag
aaagtggcaggggacatcgagagcctgctggacaggaaggtccaggccctgaagagactg
gctgacgctgcagagaatttccagaaagcccatcgctggcaggacaacatcaaggaggaa
gacatcatgtactacgatgccaaggctgacgccgagctggatgaccctgagagtgaagat
atggagaggggatccaagaccagcgccttaaggctggacttcatcgaggacccaaacttc
aagaacaaagtcaactattcatacacggctgtgcagatccccacagacatctacaaaggc
tctaccgtcatcctcaatgagcttaactggacagaggccctggagaacgtcttcattgag
aaccgtaggcaagaccctacactgttgtggcaagtctttggcagtgccacgggagtcact
cgctattacccagccacaccatggcgagcccccaagaagattgacctgtacgatgtcaga
agacgaccctggtatatacagggggcctcatcacccaaggacatggtcatcattgtggat
gtgagtggcagcgtgagcggcctgactctgaagctgatgaagacgtccgtctgtgagatg
ctagacacgctctctgatgatgactatgtgaacgtggcctcattcaacgagaaggcgcag
cctgtgtcttgcttcacacacctggtgcaggccaatgtgcgtaacaagaaggtgttcaag
gaagctgtgcagggcatggtggccaagggcaccacaggctacaaggccggctttgagtat
gcctttgaccagctacagaattccaacatcacgcgggctaactgcaataagatgatcatg
atgttcacggatgggggtgaggatcgcgtgcaggatgtcttcgaaaagtacaattggccc
aatcggacggtacgtgtgttcacgttctccgtaggacagcataactatgatgtcacaccc
ttgcagtggatggcctgtactaacaaaggttactattttgagatcccttccatcggagcc
atccgcatcaacacacaggaatacctggatgtgctgggtaggcccatggtactggcaggc
aaggacgccaagcaagtgcaatggacaaacgtgtatgaagatgcactggggctggggttg
gtggtaacaggaactctccctgttttcaacctgacacaggatggccctggggaaaagaag
aaccagttaatcctgggtgtcatgggcatcgatgtggccttgaatgacatcaaaaggctg
actcccaactacacactcggcgccaatggctatgtgttcgccatcgacctgaacggctac
gtgttgctacatcccaatctcaagccccagactaccaacttccgggagcctgtgaccttg
gacttcctggacgcagagctggaagatgagaacaaggaggagatccgtcgcagcatgatt
gacggcgacaaaggccacaagcagatcagaaccttggtcaaatccctggatgagaggtac
atagacgaagtgattcggaactacacctgggtgcctataaggagtaccaactacagcctg
gggctggtgctcccaccctacagcacctactacctccaagccaacctcagcgaccagatc
ctgcaggtcaagttgccaatcagcaaactgaaggattttgagttcctgcttcccagcagc
tttgagtctgaaggacacgttttcattgctccgagagagtattgcaaggacttgaacgcc
tcggacaacaacaccgagttcctgaagaacttcatcgagctcatggagaaagtgactccg
gactccaagcagtgtaataacttccttcttcataacttgattctggacacgggcattaca
cagcagttagtggaacgtgtgtggcgggaccaagatctcaacacgtacagcctgctagcc
gtatttgctgccactgatggtggcatcacacgtgtcttcccgaacaaggcagccgaagac
tggacagaaaaccctgaacccttcaatgccagcttctaccgtcgcagcctggataaccat
ggttatatcttcaagcccccacaccaggactccctgttaagaccactggagctggagaat
gacacagtaggtgtcctcgtcagcacagctgtggagctcagtctaggtcgtcgcacactg
aggccagcagtggtgggtgtcaaactggacctagaggcttgggctgaaaagttcaaggtg
ctggccagcaaccgtacccatcaggaccaacctcagaagtgcggccccagcagccactgt
gagatggactgcgaggttaacaacgaggatctactctgtgtcctcattgatgacggaggg
ttcctggtgctgtcaaaccagaaccatcagtgggaccaggttggcagattcttcagtgag
gtggatgccaacctgatgctggcactgtacaataactccttctacacccgaaaggaatcc
tatgactatcaggcagcctgtgcccctcagcctcctgggaacctgggtgctgcaccccgg
ggtgtctttgtgcccaccattgcagatttccttaacttggcctggtggacctctgctgcc
gcctggtccttattccagcagctactctatggtctcatctatcacagctggttccaggca
gacccggcagaagctgagggcagccccgagacgcgcgagagcagctgcgtcatgaaacag
acccagtactacttcggctcggtgaacgcatcctataatgccatcattgactgcggaaac
tgcagcaggctgttccatgcgcagagactgaccaacaccaatctcctgttcgtggtggcc
gagaagccgctgtgcagccagtgcgaggcgggccggctgctgcagaaggagacacactcg
gacggcccggagcagtgtgagctggtgcagagaccgagataccgaagaggtccgcacatc
tgttttgactacaatgcgacggaagatacctcagactgtggccgcggagcctccttccct
ccgtcgctgggcgtcttggtttccttgcagcttttgctcctcctgggcctgccacctcgg
ccgcagcctcaagtccactccttcgctgcctctcgccacctctga

DBGET integrated database retrieval system