KEGG   Mus musculus (mouse): 56809
Entry
56809             CDS       T01002                                 

Gene name
Gmeb1, 1110050A04Rik, AI256615, AI481278
Definition
(RefSeq) glucocorticoid modulatory element binding protein 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SAND
Other DBs
NCBI-GeneID: 56809
NCBI-ProteinID: NP_001116464
MGI: 2135604
Ensembl: ENSMUSG00000028901
Vega: OTTMUSG00000011110
UniProt: Q9JL60 Q3UYV4
Position
4; 4 D2.3
AA seq 562 aa
MANAEVSVPVGDVVVVPTEGNEGENPEDTKTQVILQLQPVQQGIYEAGSENSAAVVAVET
HSIHKIEEGIDASSIEGNEDMEIAYPITCGESKAVLLWKKFVCPGINVKCVKFNDQLISP
KHFVHLAGKSTLKDWKRAIRLGGIMLRKMMDSGQIDFYQHDKVCSNTCRSTKFDLLISSA
RAPVPGQQTSVVQTPTSADGNITQIAISEESMEEAGLEWNSALTAAVTMATEEGIKKESE
EISEDTLMFWKGIADVGLMEEVVCNIQKEMEELLRGVQQRLIQAPFQVTDAAVLNNVANT
FGLMDAVKRVLDNRRKQVEQGEEQFLYTLADLERQLEEQKKQAQDPRLKSQTVQNVVLMP
VSTPKPPKRPRLQRPASTTVLSPSPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGS
SPVTVHTLPSGPQLFRYATVVSSAKSNSPDTVTIHPSSSLALLSSTSMQDGSSLGNMATM
VSPMELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDSEADDTEGKAVILETGLRTEEK
VVAEMEEHQHQVHNVEIVVLED
NT seq 1689 nt   +upstreamnt  +downstreamnt
atggccaatgcagaagtgagcgtcccagtgggagatgtggttgtggtacccactgaagga
aatgaaggggagaacccggaagacactaaaactcaagtgatcttgcagttacagcctgtg
caacaagggatttatgaagctgggtcggagaatagcgcagcagttgtagccgtagagacc
cactcaatacacaaaatcgaggaaggaattgatgcaagcagtatagaagggaacgaggac
atggagatcgcttaccctataacctgtggggagagtaaagctgtcctcctctggaagaag
ttcgtgtgtccaggaataaacgtgaagtgtgtcaagtttaatgaccagctgatcagtccc
aagcacttcgttcacctggctggcaagtccaccctgaaggactggaagagagccatccgt
ctaggcggcatcatgctcaggaagatgatggactctggacagatcgatttttaccagcat
gacaaagtttgctccaatacctgcaggagcaccaaatttgacctcctgatcagcagtgcg
agggctccagtgccaggacagcagacaagtgtggtgcagacccccacctcggccgatggg
aacatcacacagatcgccatctcagaggagagcatggaagaggcagggctggagtggaac
tcagctctcaccgccgctgtcaccatggccacagaggagggtataaagaaagagtctgaa
gagatttcagaggacactttgatgttctggaaggggatagctgatgtagggttgatggag
gaggtcgtctgcaacatccagaaggagatggaagagctgctcaggggcgttcagcagcgg
ctcattcaggcccctttccaggtcacagatgctgctgttctaaacaatgtggcgaacaca
tttggcctaatggacgcggtcaagagagttttggacaacagacggaagcaagtggagcag
ggcgaggagcagtttctctacaccctggcagacttggaacggcagttggaggagcaaaaa
aagcaagcccaagatcccagactgaaatcccagacagttcaaaatgtggtactgatgccc
gtgagcaccccaaagcctccaaaaagaccccggctccagcggccagcctccaccaccgtc
ctgagcccttctcccgtccagcagcctcagtttactgtcatctctcccatcaccattact
cctgtgggccagtccttctccatgggcaacatcccagtggctaccctcagccagggctcc
agtcctgtgactgtccacacactgccttctggccctcagctcttccgctatgccacggtg
gtttcctctgccaagagcaactcaccagacacagtgaccatccacccttcctcaagtttg
gcactgctaagctccacctctatgcaggatgggagttccctgggcaacatggccaccatg
gtgagccccatggagctggtggccatggagtccggcctgacgtcagcaatccaggctgtt
gaaagcacctctgaggatgggcagaccatcattgaaatcgaccctgccccagactccgag
gctgacgacactgagggcaaagcagtcatcttggagacagggctgaggactgaggagaaa
gtggtagccgaaatggaagaacaccagcatcaggtccacaatgtggagattgtggtcttg
gaggactga

DBGET integrated database retrieval system