KEGG   Mus musculus (mouse): 56811Help
Entry
56811             CDS       T01002                                 

Gene name
Dkk2
Definition
(RefSeq) dickkopf WNT signaling pathway inhibitor 2
  KO
K02165  dickkopf
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    56811 (Dkk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dickkopf_N DUF4501
Motif
Other DBs
NCBI-GeneID: 56811
NCBI-ProteinID: NP_064661
MGI: 1890663
Ensembl: ENSMUSG00000028031
Vega: OTTMUSG00000054905
UniProt: Q9QYZ8
Structure
PDB: 

Position
3; 3 G3
AA seq 259 aa AA seqDB search
MAALMRVKDSSRCLLLLAAVLMVESSQLGSSRAKLNSIKSSLGGETPAQSANRSAGMNQG
LAFGGSKKGKSLGQAYPCSSDKECEVGRYCHSPHQGSSACMLCRRKKKRCHRDGMCCPGT
RCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMPHIKGHEG
DPCLRSSDCIDGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCK
VWKDATYSSKARLHVCQKI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgctgatgcgggtcaaggattcatcccgctgccttctcctactggccgcggtg
ctgatggtggagagctcacagctaggcagctcgcgggccaaactcaactccatcaagtcc
tctctaggaggggagactcctgctcagtcagccaaccgatctgcaggcatgaaccaagga
ctggctttcggcggcagtaagaagggcaaaagcctggggcaggcctacccttgcagcagt
gataaggaatgtgaagttggaagatactgccacagtccccaccaaggatcatcagcctgc
atgctctgtaggaggaaaaagaaacgatgccacagagatgggatgtgttgccctggtacc
cgctgcaataatggaatctgcatcccagtcactgagagcatcctcaccccacatatccca
gctctggatggcacccggcatagagatcgcaaccatggtcactattccaaccatgacctg
ggatggcagaatctaggaaggccacactccaagatgcctcatataaaaggacatgaagga
gacccatgcctacggtcatcagactgcattgatgggttttgttgtgctcgccacttctgg
accaaaatctgcaaaccagtgctccatcagggggaagtctgtaccaaacaacgcaagaag
ggttcgcacgggctggagattttccagaggtgtgactgtgcaaagggcctgtcctgcaaa
gtgtggaaagatgccacctactcttccaaagccagactccatgtatgccagaagatctga

DBGET integrated database retrieval system