KEGG   Mus musculus (mouse): 56846
Entry
56846             CDS       T01002                                 

Symbol
Necab3, 2900010M17Rik, AI853434, Apba2bp, Nip1, XB51
Name
(RefSeq) N-terminal EF-hand calcium binding protein 3
  KO
K23854  N-terminal EF-hand calcium-binding protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    56846 (Necab3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   56846 (Necab3)
SSDB
Motif
Pfam: ABM EF-hand_5 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 56846
NCBI-ProteinID: NP_067521
MGI: 1861721
Ensembl: ENSMUSG00000027489
Vega: OTTMUSG00000015792
UniProt: Q9D6J4
Position
2:complement(154386311..154401326)
AA seq 353 aa
MACAGLLTVCLLGPPAPQQPRHSAPAAGHALFQDVFRRADKNDDGKLSFEEFQNYFADGV
LSSAELRELFSGIDDHLTDNLETEKLCDYFSTHLGVYRPVLAALESLNRAVLTAMDTTKL
EYEQASKVDQFVTRFLLRETVNQLQALQTSLEGASDTLEAQAHGQRLDEETIKAQSRPCG
SRRAGRRALRSISWSPSWSPGSSDTGRSSEAEQQWRLQVNRLQELIDQLECKAPRLEPTH
EEDLTKGFDSHILVAQRQVQVAEDALQDFHRALCCYMNFTGAQSHCLHVSAQKMLDNAAF
TLYEFWQDEASWRRHQQSPCSKAFQRTLIDHLQAPDTLTTVFFPASWWIMNNN
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggcgtgcgccgggctgcttactgtgtgcctgctcgggccacctgcgccccagcagccg
cgacactctgcgcctgccgcgggacacgcgcttttccaggacgttttccgaagagcagac
aaaaatgatgatggtaagctctcgtttgaagaattccagaattactttgctgatggggtt
ctcagctctgcggagctgcgggaactgttcagcggcatcgatgatcatctcactgacaat
ttagagacagagaaactgtgtgactacttctccacacacctgggtgtctaccggcccgtg
ctggctgcgctggagtctctgaaccgtgcggtgctcactgccatggacactacaaagctg
gagtatgaacaggcctccaaggtggaccagtttgtcacacgatttctgctgcgggagact
gtcaatcagctacaagccctgcagacctccctggagggagcatcagacaccctggaggcg
caggcccatggccagcggttggatgaagaaactatcaaagcgcagagtaggccctgtggc
agccggagggcaggacgcagagccctaaggagcatcagttggtcaccatcctggtctcct
ggatcctctgatacagggcggagttcagaggctgagcagcagtggcggctacaggtcaac
cgcctccaggagctcatagaccagcttgagtgcaaggcaccccggctggaacccacacat
gaggaggacctcaccaaggggtttgactcgcacatccttgtggcgcagaggcaagtgcag
gtggcagaggatgccctgcaggattttcatcgtgctttgtgctgctacatgaacttcaca
ggggcccaaagccattgtctgcatgtgtctgcccagaagatgctagacaatgctgctttc
accctgtatgagttctggcaggatgaagcctcctggagaaggcaccagcagtcaccctgc
agcaaggccttccagcgcaccctcatcgatcacctgcaggccccggacactctcaccact
gtgttcttcccagcctcctggtggattatgaataataactga

DBGET integrated database retrieval system