KEGG   Mus musculus (mouse): 57247
Entry
57247             CDS       T01002                                 

Symbol
Zfp276, AW048709, D8Ertd370e, D8Ertd377e, Znf276
Name
(RefSeq) zinc finger protein (C2H2 type) 276
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-AD zf-H2C2_2 zf_UBZ INO80_Ies4 zf-C2H2_aberr zf-C2H2_6 CpXC Zn-ribbon_8 DUF2197
Other DBs
NCBI-GeneID: 57247
NCBI-ProteinID: NP_065243
MGI: 1888495
Ensembl: ENSMUSG00000001065
Vega: OTTMUSG00000022150
UniProt: Q8CE64
Position
8:123980934..123997290
AA seq 614 aa
MKRDRLGRFLSPGIARQRGGSGGGCGSGRTRGRPSRSGGTSADGAAAQLSWGSMTRSCGD
TGDDGTDEAGAGRTLAMGHCRLCHGKFSSRSLRSISDRVPGETSERLSPGERVFIRDFQR
LLGVAVHQDPALPQSVCKNCYTQFYQCHSLLRTFLQRVNVSPAGQRKPCTKVGVQPTTVA
EEGACVADLIASSPRCLHGLVGWVHEHAVSCGSLPSLQRTLSSEYCGIIQAVWGCDQGHD
FTMDTASSCRALFLDSALAVKWAWGKDLSPRLAQNSESNPTGAASRLCQARETQVGSETK
TLPSVDVALLHSHGDSVGPGLGPCTQPHLAPSEAPGQLGETQVPSSTSDDRVKDEFSDLS
EGDFLSEDESDKKQTPQSSDESFEPYPEKKVSGKKSEGREAKRPEEPKIRKKPGPKPGWK
KKLRCEREELPTIYKCPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPHPGCNKVFMIDR
YLQRHVKLIHTEVRNYICDECGQTFKQRKHLLVHQMRHSGAKPLQCEVCGFQCRQRASLK
YHMTKHKAETELDFACDQCGRRFEKAHNLNVHMSMVHPLTQAQDRALPLEAEPPPGPLSP
SGTMEGQAVKPEPT
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgaagcgggaccgcctcggccgcttcctgtctcccggaatagctcggcagcgcgggggt
tcgggcggcggctgtggaagcggtcggactcggggtcgcccttctcgcagcggcggaacg
agcgctgacggggcggctgctcagctcagctggggctcgatgacacgctcctgcggggac
acaggcgacgacggtacagacgaagctggagcaggccggactctcgctatggggcattgt
cgactctgccatgggaagttttcctcacggagcctccgaagcatctctgacagagtgcct
ggggagacttcagaaagactgtccccaggagagcgtgtcttcattagggacttccagcgt
ctgctgggtgtcgctgtgcaccaggacccagccctgcctcagtctgtctgcaagaactgc
tacacccaattctatcagtgccacagccttctcaggaccttcttacagagagtcaacgtc
tccccagctggccagaggaagccttgtacaaaggttggtgttcagcctaccacagtggca
gaggagggagcatgtgtggctgacctgatcgcctccagccctcggtgtctgcacggcttg
gtgggctgggtgcatgagcatgcagtcagctgtgggtctctgcccagcctccagaggaca
ctgtcctctgagtactgcggcatcatccaggctgtgtggggctgcgaccagggccacgac
ttcaccatggacacagcctccagctgcagagctctctttttggacagtgcattagcagtg
aaatgggcgtggggcaaggacctgtcaccacggctggcccagaactcagagtccaacccc
acgggagctgcctctcggctctgccaggccagagaaacccaagttggatctgagaccaag
acactccccagtgtggatgtggccctgctgcactcacatggagactctgtgggacctggg
ctaggcccctgtacgcagccacacttggctcccagtgaggccccagggcaactgggtgag
acgcaggttccctcgtcaacctcggatgatcgggtaaaagacgagttcagtgacctttct
gagggagacttcctgagcgaagatgagagtgataagaaacagacacctcagtcctcggat
gagtcctttgagccttacccagaaaagaaggtctctggtaagaagagcgaaggcagagaa
gccaagaggcctgaagagcccaagatcagaaagaagcctgggcccaagcccggatggaag
aaaaagcttcgctgtgagagggaggagctgcccaccatctacaagtgtccttaccagggc
tgcacagctgtataccgtggcgctgatggcatgaagaagcacattaaggagcaccatgag
gaggtccgggaaaggccctgcccacaccctggctgcaacaaggtattcatgatcgaccga
taccttcagcgacacgtgaagctcatccacacagaggtccgcaattacatctgtgacgag
tgcgggcagaccttcaagcagcggaagcaccttctcgtccaccagatgcgccactcggga
gccaagccactgcagtgtgaggtctgtgggttccagtgcaggcaacgagcatccctcaag
taccacatgaccaaacacaaagcagagactgagctggacttcgcctgtgaccagtgcggc
cgacgctttgaaaaggcccacaacctcaacgtgcatatgtccatggtccatcctctgacc
caggcccaggacagagccctgcctctggaagcagagccgccacctgggcctctgagcccc
tctgggaccatggagggtcaggctgtgaagccggagcctacctga

DBGET integrated database retrieval system