KEGG   Mus musculus (mouse): 57249
Entry
57249             CDS       T01002                                 

Gene name
Gabrq
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit theta
  KO
K05192  gamma-aminobutyric acid receptor subunit theta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    57249 (Gabrq)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    57249 (Gabrq)
   04723 Retrograde endocannabinoid signaling
    57249 (Gabrq)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    57249 (Gabrq)
   05033 Nicotine addiction
    57249 (Gabrq)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    57249 (Gabrq)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   57249 (Gabrq)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 57249
NCBI-ProteinID: NP_065234
MGI: 1888498
Ensembl: ENSMUSG00000031344
Vega: OTTMUSG00000017852
UniProt: Q9JLF1 Q0VEX8
Position
X; X A7.3
AA seq 638 aa
MGIRGMLRAAALLLLIRTWLAESNGPSPTPKFHFELSSSTPEVILDLFNCKNCANEAVVQ
KILDRVLSTYDVRLRPNFGGAPVPVSVSIYVSSIEQISEINMDYTITMFLHQTWKDTRLA
YYETNLNLTLDYRMHEKLWVPDCYFVNSKDAFVHDVTVENRVFQLHPDGTVRYGIRLTTT
AACSLDLQKFPMDKQSCKLEVESYGYTVEDIVLSWEDDNAIHITDGLHIPQYTYLGRTIT
SKEVYFYTGSYMRLIVKFQVQREVRSYLVQVYWPTVLTTILSWISFWMNYDSSAARVTIG
LTSILVLTTIDSHMRDKLPHISCIKAIDIYILVCLFFVFLSLLEYVYINYLFFSQVPRRN
HRRCRKPRRVVARYRYQEVVVANVQDGLINVEDRVEDRAGPLPDSPMQAHLASQESLGSL
VFTSEQAQLATSESLSLLSSASSQTQLATGESLSDLPSTSEQTVPECTIHFHGFLTNDSI
IPIKIHSRSDACDDEDSEESLSSEESHGHGSSHTGRLKLQISQRCVQEASWDLDKIEILQ
DDISITSSWLGLDEQCKGDADSIWSLTDEELMACDQEKDSSSESEENCSPSPGCSFNEGF
SFQLFKPNRVPKVDRWSRFLFPLSFGLFNVVYWLYHVY
NT seq 1917 nt   +upstreamnt  +downstreamnt
atgggcatccgaggtatgctgcgagccgctgcgctcctgctgctcattaggacttggctg
gcagagagtaacggccccagtcccaccccgaaattccacttcgagctctcctccagcacg
cctgaagtcattctggatctcttcaactgcaaaaactgtgcaaatgaagctgtggttcaa
aagattttggacagggtgctgtcaacatatgatgtccgacttagaccaaattttggagga
gctcctgtgcctgtgtcagtatctatctatgtgtccagtattgaacagatctcagaaata
aatatggactatacaatcacaatgtttttgcatcagacctggaaggacacacgcttagct
tactatgaaaccaacctaaacctgaccctggattatcggatgcatgagaagctctgggtt
cctgactgctactttgtgaatagcaaagatgcctttgtgcatgatgtaactgtggagaat
cgtgtatttcaacttcacccagatgggacagtgcgatatggcatccgacttaccacaaca
gcagcctgttccctggatctgcaaaaattccctatggacaaacaatcctgcaagctggag
gtggagagctatggctacactgtcgaagacattgtgttatcctgggaagatgataatgcc
atccacattactgatgggctgcatatccctcagtacacgtacctggggagaacaattacc
agcaaggaagtgtacttctacacaggctcctacatgcgcctgatagtgaagttccaggtt
cagagggaagtccgcagttaccttgtgcaggtctattggcccacggtcctcaccaccatt
ctctcctggatatcattttggatgaactatgattcctctgcagccagggtaactattgga
ctaacttcgatccttgtcctgactaccatcgactcacatatgcgggataaactcccccat
atttcctgtatcaaagctattgacatctacatccttgtatgcctattcttcgttttcctg
tcactgctggagtatgtctacatcaactaccttttcttcagccaagtacctcggcgtaat
cacagaagatgcaggaaacccaggagagttgttgcccgataccgctaccaagaagtggtg
gtagcaaatgtgcaggatggcctgattaatgtggaagacagagtagaagacagagctggt
ccccttcctgacagccccatgcaggctcatctggcaagccaggaaagtctaggatccttg
gtgttcacatcagagcaggcccagctggctacctcagaaagtctcagtctactctcttct
gcctcaagccagactcaattggccactggagaaagcctgagtgatctgccctccacctct
gagcaaacagtgcctgagtgtaccattcactttcatggctttcttactaatgacagtatt
atccccatcaaaatccacagccgatctgatgcctgtgatgatgaagactccgaagaaagc
ctaagctctgaggagagccatggccatggaagcagccacactggaaggctcaagctccag
attagccagaggtgtgtgcaagaagcaagttgggaccttgataaaattgagatcttacag
gatgacatcagtatcacgagcagctggcttggccttgatgaacaatgcaagggggatgct
gacagtatctggagccttactgatgaggagctcatggcctgtgaccaagagaaggacagt
agctcagagtctgaggagaattgctccccaagccctgggtgctccttcaatgaagggttc
tcttttcagctctttaaacctaaccgggtccccaaggttgatagatggtcccgtttcctc
tttcctctttcctttgggctgttcaatgtggtttactggttataccatgtctattag

DBGET integrated database retrieval system