KEGG   Mus musculus (mouse): 57259
Entry
57259             CDS       T01002                                 

Symbol
Tob2, 2900090N22Rik, 4930545K18Rik, AV071822, mKIAA1663
Name
(RefSeq) transducer of ERBB2, 2
  KO
K14443  protein Tob/BTG
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    57259 (Tob2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    57259 (Tob2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     57259 (Tob2)
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     57259 (Tob2)
SSDB
Motif
Pfam: BTG PAM2
Other DBs
NCBI-GeneID: 57259
NCBI-ProteinID: NP_065253
MGI: 1888525
Ensembl: ENSMUSG00000048546
UniProt: Q9JM55 Q543X9
Position
15:complement(81732471..81744742)
AA seq 345 aa
MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLRKKYEGHWYPEKPLKGSGFRCVHI
GEVVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIGEKGVVKVLYLGDSEAS
GTPELDKEIKSSFNPDAQVFVPIGSQDSSLSSSPSPSFGQSPSPTFIPRSAQPITFTTAS
FAATKFGSTKMKKGGGASGGVSVGGSGAGGQQPPPQQPRMARSPTKNLLKHKSLSLSMHS
LNLIPANPAPQSQLSPNAKEFVYNGGGSPSLFFDGVEGPSTSTTAPFGSGGASTCNSSSF
DVSQVFGGGANSLFLEKSPFVEGLSYNLNTMQYPNQPFQPVVLAN
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgcagctggagatcaaagtggccctcaacttcatcatctcctacttatacaacaagctg
ccccgccgcagggcagacctgtttggggaggagctagagcggcttctgagaaagaaatat
gagggccactggtacccggagaagccgttgaagggttctggcttccgctgtgtccacatt
ggggaagtggtagaccctgtggtggagctggctgccaagcggagcggcctagctgtggag
gatgtgcgtgccaacgtgcccgaagagctgagtgtctggattgaccctttcgaggtatcc
taccagattggcgagaagggagtcgtgaaggtcctgtacctgggtgacagtgaggcgagt
ggtaccccagagctggacaaagagatcaagagcagcttcaaccctgacgcccaggtgttt
gtgcccatcggcagccaggacagctctctgtccagctctccctcgccgtcctttggccag
tcacccagccccaccttcatcccccggtctgcccagcccatcacctttactactgcctct
tttgctgccaccaaatttggttccactaagatgaagaagggtggtggggcatctggcggt
gtgagtgtgggtggcagcggggcgggtggccagcagccgccgccacagcagcctcgcatg
gcccgctcacccacaaagaacctgctgaagcacaagagcctctctctatctatgcattca
ctgaacctcatcccagccaatccggccccccagtcccagctctcccccaatgccaaggag
tttgtgtacaacggtggtggctcacccagcctcttcttcgatggggtggaaggcccgagc
accagcaccacggcccccttcggcagcggtggagccagcacttgcaacagcagcagcttt
gatgtgtcccaggtgttcggaggcggtgctaacagcctgttcttggagaaatcgcccttt
gtggaaggcctcagctacaacctgaataccatgcagtatcccaaccagcccttccagcct
gtcgtgctggccaactga

DBGET integrated database retrieval system