KEGG   Mus musculus (mouse): 57261Help
Entry
57261             CDS       T01002                                 

Gene name
Brd4, Brd5, HUNK1, MCAP, WI-11513
Definition
(RefSeq) bromodomain containing 4
  KO
K11722  bromodomain-containing protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    57261 (Brd4)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    57261 (Brd4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    57261 (Brd4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  BRD family [OT]
   57261 (Brd4)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Brd4/P-TEFb complex
     57261 (Brd4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    57261 (Brd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain BET BRD4_CDT
Motif
Other DBs
NCBI-GeneID: 57261
NCBI-ProteinID: NP_065254
MGI: 1888520
Ensembl: ENSMUSG00000024002
Vega: OTTMUSG00000030241
UniProt: Q9ESU6 Q3UH70
Structure
PDB: 

Position
17 B1; 17 17.39 cM
AA seq 1400 aa AA seqDB search
MSTESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT
NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
RGRKETGAAKPGVSTVPNTTQASTSPQTQTPQQNPPPPVQATTHPFPAVTPDLIAQPPVM
TMVPPQPLQTPSPVPPQPPPPPAPVPQPVQSHPPIIATTPQPVKTKKGVKRKADTTTPTT
IDPIHEPPSLAPEPKTAKLGPRRESSRPVKPPKKDVPDSQQHPGPEKSSKISEQLKCCSG
ILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLESREYRDAQEFG
ADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVTVSSPAVPPPTKV
VAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKK
EKDKKEKKKEKHKKKEEVEENKKSKTKELPPKKTKKNNSSNSNVSKKEPVPTKTKPPPTY
ESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETL
KPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESTSESSSSDSEDSET
EMAPKSKKKGHTGRDQKKHHHHHHPQMQPAPAPVPQQPPPPPQQPPPPPPPQQQQQQPPP
PPPPPSMPQQTAPAMKSSPPPFITAQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPH
LPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPTRPPAVSPALAQPP
LLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPL
PPPPHPSVQQQQLQPQPPPPPPPQPQPPPQQQHQPPPRPVHLPSMPFSAHIQQPPPPPGQ
QPTHPPPGQQPPPPQPAKPQQVIQHHPSPRHHKSDPYSAGHLREAPSPLMIHSPQMPQFQ
SLTHQSPPQQNVQPKKQVKGRAEPQPPGPVMGQGQGCPPASPAAVPMLSQELRPPSVVQP
QPLVVVKEEKIHSPIIRSEPFSTSLRPEPPKHPENIKAPVHLPQRPEMKPVDIGRPVIRP
PEQSAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSF
EHFRRAAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQE
QQQQQQQQRQEQQQQQQQAAAVAAASAPQAQSSQPQSMLDQQRELARKREQERRRREAMA
ATIDMNFQSDLLSIFEENLF
NT seq 4203 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggagagcggccctgggacaagattgagaaatctgccagtaatgggggatgga
ctagaaacctcccaaatgtctacaacgcaggcccaggcccaaccccagccagcaaatgca
gccagcaccaatcctccacccccagagacctccaaccctaacaagcccaagagacagaca
aaccaactgcaatatctgctcagagtggtgctcaagacactatggaaacaccagtttgcg
tggcctttccagcagcccgtggatgccgtcaagctgaacctccctgattactataagatt
attaaaacacccatggatatgggaacaataaagaagcgcttggaaaacaactattactgg
aatgctcaggaatgtatccaggacttcaacactatgtttacaaattgttacatctataac
aagcctggagatgacatcgtcttaatggcagaagctctggagaagctcttcttgcaaaaa
atcaatgaactgcctacagaagaaactgagatcatgatagtccaggcaaaaggaagagga
cgagggaggaaagaaacaggggcagcaaagcctggtgtatccacggtaccaaacacaact
caagcatcaacttctccgcagacccagacgcctcagcagaaccctcctccacctgtgcag
gccacaactcacccctttcctgctgtcaccccagacctcattgcccagcctcctgtcatg
acaatggtgccccctcagccacttcagactccttcaccggtacccccccagccaccaccc
ccacctgctccagttccacagcctgtgcagagtcacccgcccatcattgcgaccaccccc
cagcctgtgaagacaaagaaaggggtgaagaggaaagcagataccaccacccctaccacc
atcgaccccattcatgagccaccctcactggccccagagcccaagaccgccaagctgggt
cctcggcgggagagcagcagacctgtgaagcctccaaagaaggatgtaccggactcacag
cagcacccagggccagagaagagcagcaagatctctgagcagctaaagtgctgcagtggc
atcctcaaggagatgtttgccaagaaacatgctgcctatgcctggcctttctacaagcct
gtggatgtggaggcactgggtctgcacgactactgtgacatcatcaaacatcccatggac
atgagcacaatcaagtctaaactagagtcccgagagtacagagatgcccaggaatttggt
gctgatgtccgattgatgttctccaactgctacaagtacaacccccctgaccatgaagtg
gtagccatggctcgaaaactccaggatgtgtttgaaatgcgctttgccaagatgcctgat
gagcctgaagagccagttgttacagtgtcctctcctgcagtgccaccccctacaaaggtg
gtagccccaccctcatctagtgacagcagcagcgacagttcttccgacagcgacagttcc
actgacgactctgaggaagagcgagcccagcggctggctgaactccaggaacagctcaag
gccgtgcatgagcagcttgcagccctctcacagccccagcagaacaaaccaaagaaaaag
gagaaggacaagaaggaaaagaaaaaggaaaagcacaaaaagaaagaagaagtggaggaa
aataaaaaaagcaaaaccaaggaacttcctcccaaaaagacaaagaaaaataacagcagc
aacagcaatgtgagcaagaaggaaccagtacccacgaagaccaagccgcctcccacatat
gaatcagaagaggaggataagtgtaagcccatgtcttatgaggagaagcggcagctaagt
ctagatatcaacaaacttcctggtgagaagctaggccgtgtagtacacataattcagtca
agggaaccatcacttaaaaactccaaccccgatgagattgagattgactttgagaccctg
aagccatctacactacgagagttggagcgatatgtcacctcctgtttgcggaagaaaagg
aaacctcaagctgaaaaagttgacgtgattgctggttcttccaagatgaagggattctca
tcctctgagtcggagagcaccagcgaatccagctcctctgacagtgaagactctgaaaca
gagatggctcccaagtcaaaaaagaaggggcacactgggagggaccagaaaaagcatcat
caccatcaccatccacagatgcagccagccccagctcctgtgccccagcagccgccccca
cctccacagcagcctcctccacccccacctccgcagcagcagcagcagcaacctccaccc
ccaccacctccgccctccatgccacagcagactgccccagcgatgaagtcctcgccccca
cccttcatcactgcccaggtccccgtcctggaaccacagctgccaggcagtgtctttgac
cctattggccacttcacccagcccatcttgcacctgccgcagccggagctgcctcctcac
ctgccccagccacctgagcacagcactccaccccatctcaaccagcatgctgtggtctct
cctccagctttgcacaatgcgctgccccaacagccatctcggcccagtaaccgagctgct
gctctgcccccaaagcctacccgacccccagctgtgtcccctgccctggcccagcccccc
ctgctcccacaaccaccaatggctcagcccccccaagtgctgctggaggatgaagagcca
cctgccccacccctcacctccatgcagatgcagttgtacctacagcagctgcagaaggtg
cagcctcccacaccactactcccttccgtgaaggtgcagtcccaacccccaccgcctttg
ccgcctccaccccacccttctgtgcagcagcagcagctccagccacagccaccgccaccc
ccacctcctcagccacagccaccaccccagcaacaacaccagcctccaccacgaccagtt
cacttgccatccatgcccttttctgctcatattcagcagcccccaccacccccaggacag
caacctactcacccacccccaggacagcagcccccaccaccacagcctgccaagccccag
caagtcatccagcatcacccttccccccggcaccacaagtcagacccctactcagctggt
catcttcgtgaggctccctctccgcttatgatacattcccctcagatgccacagttccag
agcctgacccatcagtctcctccccagcaaaacgtccagcctaagaagcaggtaaagggc
agggctgagccacagccaccagggccagtcatgggccaaggccagggatgcccacctgcc
tcaccggctgccgtgcctatgctgtcccaggagctgcgaccaccttcagtcgtccagccc
cagcccctggtggtagtaaaggaggagaagattcactcaccaatcattcgcagcgagcct
ttcagcacctcacttcgaccagagccccccaagcacccagagaacatcaaggccccagtc
cacctgccccagcggcctgagatgaagcctgtagacatagggaggcctgtgatccggcct
ccagagcagagtgcacccccaccaggggcccctgacaaggacaaacagaagcaggagcca
aaaacaccagtggcacccaaaaaggacctgaaaattaagaacatgggctcctgggccagc
ctggtacagaagcatccgaccaccccatcctccacagccaagtcctcaagtgacagcttt
gagcatttccgccgtgctgctcgggagaaggaggagagggaaaaggccctgaaggctcag
gctgagcatgcagagaaggagaaggagcggctgaggcaggagcgcatgaggagccgagag
gatgaagatgcgctggaacaggcacgtcgagcccatgaggaggcacgacggcgccaggag
cagcagcagcagcagcagcagcagagacaggagcagcagcagcagcagcagcaggcagct
gctgtggccgctgcctctgccccccaggcccagagctcccagccccagtctatgctggac
cagcagagggagttggcccggaaacgagagcaggagcggaggcgcagggaggcaatggca
gctacaattgacatgaatttccagagtgatcttttgtcaatatttgaagaaaatcttttt
tga

DBGET integrated database retrieval system