KEGG   Mus musculus (mouse): 57263
Entry
57263             CDS       T01002                                 

Gene name
Retnlb, 9030012B21Rik, Fizz, Fizz2, RELMbeta, Rel, Relmb, Xcp, Xcp3
Definition
(RefSeq) resistin like beta
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Resistin
Other DBs
NCBI-GeneID: 57263
NCBI-ProteinID: NP_076370
MGI: 1888505
Ensembl: ENSMUSG00000022650
UniProt: Q99P86 A0A0R4J042
Structure
PDB: 
1RH7

Position
16 B5; 16 30.75 cM
AA seq 105 aa
MKPTLCFLFILVSLLPLIVPGNAQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLAS
CPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
NT seq 318 nt   +upstreamnt  +downstreamnt
atgaagcctacactgtgtttccttttcatcctcgtctcccttctcccactgatagtccca
gggaacgcgcaatgctcctttgagtctttggtggatcaaaggatcaaggaagctctcagt
cgtcaagagcctaagacgatctcctgcactagtgtcacgtcttctggcagactggcctcc
tgtcctgctgggatggttgtcactggatgtgcttgtggctatggctgtggatcgtgggat
atccggaatggaaatacttgccactgccagtgctcagtcatggactgggcctctgcccgc
tgctgccgaatggcttaa

DBGET integrated database retrieval system