KEGG   Mus musculus (mouse): 57274Help
Entry
57274             CDS       T01002                                 

Gene name
Slc16a8, Mct3
Definition
(RefSeq) solute carrier family 16 (monocarboxylic acid transporters), member 8
  KO
K08185  MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    57274 (Slc16a8)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC16: Monocarboxylate transporter
   57274 (Slc16a8)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Monocarboxylate porter (MCP) family [TC:2.A.1.13]
    57274 (Slc16a8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-GeneID: 57274
NCBI-ProteinID: NP_065262
MGI: 1929519
Ensembl: ENSMUSG00000032988
Vega: OTTMUSG00000036033
UniProt: O35308 Q5UB50
Position
15; 15 E1
AA seq 492 aa AA seqDB search
MGAGGPRRGAGPPDGGWGWVVLGACFVVTGFAYGFPKAVSVFFRELKRDFGAGYSDTAWV
SSIMLAMLYGTGPLSSILVTRFGCRPVMLAGGLLASAGMILASFASRLVELYLTAGVLTG
LGLALNFQPSLIMLGLYFERRRPLANGLAAAGSPVFLSMLSPLGQLLGERFGWRGGFLLF
GGLLLHCCACGAVMRPPPGPPPRRDPSPHGGPARRRRLLDVAVCTDRAFVVYVVTKFLMA
LGLFVPAILLVNYAKDAGVPDAEAAFLLSIVGFVDIVARPACGALAGLGRLRPHVPYLFS
LALLANGLTDLISARARSYGTLVAFCIAFGLSYGMVGALQFEVLMATVGAPRFPSALGLV
LLVEAVAVLIGPPSAGRLVDALKNYEIIFYLAGSEVALAGVFMAVTTYCCLRCSKNISSG
RSAEGGASDPEDVEAERDSEPMPASTEEPGSLEALEVLSPRAGSPEQEPEEEAVPELDHE
SIGGHEARGQKA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctggcggtccgaggcggggtgctggccctccggatggtggctggggctgggtg
gtgctgggcgcctgcttcgtggtcaccggcttcgcctatggcttccctaaggctgtgagc
gtcttcttccgagagctcaagcgcgactttggggcaggttacagtgacacagcctgggtg
tcctccatcatgttggccatgctctacggcacgggccccttgtccagcatcctcgtgacg
cgctttggctgtcgccccgtgatgctggctggtggactgctggcttcagcaggcatgatt
ctggcttcctttgcctcgcgcctcgtggagctgtacctgacggctggggtgctcacaggc
ctgggcctagctctcaacttccagccgtcgctcatcatgctgggactctacttcgagcgg
cgacggcccctggccaacgggctggcagcggcgggcagtcccgtgtttctgtccatgctg
tcgccgctcgggcagctgctgggggagcgcttcggctggcgtggcggcttcctgctgttt
ggcggcctcctgctgcactgttgcgcctgtggggcagtcatgcgtccgccccctggaccc
ccgccgcgcagagacccctcgccccacggtggcccggctcgccgccggcggctgctggac
gtggcagtgtgcaccgaccgtgctttcgtggtgtacgtggtcaccaagttcctgatggca
ctcgggctctttgtgccggccatcctgctggtgaactacgccaaggacgcgggcgtgcct
gacgccgaggccgccttcttgctgtccatcgtgggcttcgtggacatcgtggcacgaccg
gcgtgcggtgctttggcgggtctggggcgcctgagaccccacgtcccctacctcttcagc
ctggccctgttggccaatgggctcacggacctgattagcgcgcgtgcgcgctcctacggg
accctcgttgctttctgcattgccttcggcctgtcctacggcatggtgggcgcactgcag
tttgaggtgctcatggcaaccgtgggtgcaccccgcttccctagtgcattgggcctagtg
ctgctcgtggaggccgtggctgtgctcataggaccgccctctgccggccgcctggtggat
gctctgaagaactatgaaatcatcttctaccttgctggctctgaagtggccttggcagga
gtcttcatggcagttaccacctactgctgcctgcgctgctctaagaacatctcatcaggt
cgatctgctgagggaggagccagcgacccagaggatgtggaggctgagagggactctgag
ccaatgcctgccagcactgaggagccgggcagccttgaagctctggaggtgctgagcccc
cgggctgggtccccagaacaagaaccagaggaggaggcagtgcctgagctggatcacgag
tccataggtggccatgaggcacgaggccagaaggcatga

DBGET integrated database retrieval system