KEGG   Mus musculus (mouse): 57276
Entry
57276             CDS       T01002                                 

Gene name
Vsig2, 1190004B15Rik, 2210413P10Rik, AU040484, CTX, Ctm
Definition
(RefSeq) V-set and immunoglobulin domain containing 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2
Other DBs
NCBI-GeneID: 57276
NCBI-ProteinID: NP_065264
MGI: 1928009
Ensembl: ENSMUSG00000001943
Vega: OTTMUSG00000063094
UniProt: Q9Z109
Position
9; 9 A4
AA seq 328 aa
MAWPLVGAFLCGHLLGFVCLSGLAVEVTVPTEPLSVPKGKTAELSCSYKTSVGDNFALEW
SFVQPGKPISASVPVLYFTNGHLYPTGSKADRAILLHDPPTGGLATLKLTDLRPSDTGTY
LCNVNNPPDFYTNGLGLINLTVLVPPSHPLCSQSGQTSVGGSAALGCRSSEGAPKPVYNW
ERLGSSPTPPPGSMVQDEVSGQLILTNLSLTSSGTYRCVASNQMGSASCELNLSVTDSSE
GRVAGTLIGVLLGVLLLSVAAFCLIRFQKERKKEPKETYGGSDLREDATAPGVFEQASMR
ADHSKELLEKSPCASTMTTTKSKLSMVV
NT seq 987 nt   +upstreamnt  +downstreamnt
atggcctggcccctggtgggggctttcctttgcgggcacttgctgggcttcgtgtgcctg
agcgggctagctgtggaggtgactgtgcccactgagccactgagcgtgccaaagggtaag
acggccgagctgagctgcagttacaaaacatcggtgggcgacaactttgccttggagtgg
agctttgtgcagcctgggaagcccatctctgcgtccgtgcccgttctgtacttcaccaat
ggccacctgtatcccactggctctaaagcagatcgggccatccttctccacgatccaccc
acaggaggactggctaccctgaaactgactgacctccgcccttcagacactgggacctac
ctctgcaatgttaacaacccaccagatttctacaccaacgggttggggttaatcaacctt
actgtgctggtgccccccagtcaccccttatgcagccagagtgggcaaacctctgtggga
ggttctgctgcactgggatgccgctcctctgagggagcacccaagccagtgtacaactgg
gaacgtctcggatcttctcctacacctcctcctggtagcatggttcaagatgaagtgtcc
ggccagctcattcttaccaatctctccctgacctcctctggcacctaccgatgtgtggcc
agcaaccagatgggcagtgcctcctgtgagctgaacctctccgtgactgactcatctgaa
ggccgagtagctgggactcttattggggtgctgctgggagtgctgctcctgtcagtcgcc
gcattctgcctcatcaggttccagaaagagaggaaaaaggagcccaaggagacctatggg
ggtagtgaccttcgggaggatgcaaccgctcctggggtttttgagcaagcttctatgaga
gccgatcatagcaaagagctcctggagaagtctccatgtgccagcaccatgaccaccact
aagtccaaactctctatggttgtctga

DBGET integrated database retrieval system