KEGG   Mus musculus (mouse): 57278
Entry
57278             CDS       T01002                                 

Symbol
Bcam, 1200005K12Rik, B-CA, B-CAM, Gplu, L, Lu
Name
(RefSeq) basal cell adhesion molecule
  KO
K06578  Lutheran blood group glycoprotein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    57278 (Bcam)
CD molecules [BR:mmu04090]
 Proteins
  57278 (Bcam)
SSDB
Motif
Pfam: Ig_3 C2-set_2 Ig_2 I-set ig V-set Ig_4 Izumo-Ig SKG6
Other DBs
NCBI-GeneID: 57278
NCBI-ProteinID: NP_065232
MGI: 1929940
Ensembl: ENSMUSG00000002980
Vega: OTTMUSG00000031720
UniProt: Q9R069
Position
7; 7 A3
AA seq 622 aa
MEPPDARAGLLWLTFLLSGYSGAQAELHVSVPPRVEVMRGEQVALDCTPREHPEHYVLEW
FLVDGTGARHRLASVEPQGSEFLGTVHSLGRVPPYEVDSRGRLVIAKVQVGDGRDYVCVV
KAGAAGTSEATSSVRVFATPEDTEVSPNKGTLSVMDQFAQEIATCSSNNGNPVPRITWYR
NGQRLEVPMEVNQKGYITIRTVREASGLYSLTSTLYLRLHKDDRDANFHCAAHYDLPSGQ
HGRLDSHTFRLTLHYPTEHVEFWVGSPSTTEGWVREGDAVQLLCQGDGSPSPEYSFFRQQ
GTQEEQLNVNLKGNLTLERVHRNQSGIYGCRVEDYDADEEVQLVKKLKLHVAYLDPLELS
VPEELFVFLNSSSTVVNCSARGLPTPTVRWTKDSVTLADGPMLSLQSVTFDSAGTYTCEA
STPTVPLLSRTQSFQLIVQGAPELKPNEIMPKSGNSWTEGDEVMLTCSARGFPEPKLTWS
QRGDTPAEPPFEGRGWKSSSLMVKVTSALSREGVSCEASNIHGKKGHVFHFGSVAPQTAQ
AGVAVMAVAVSVGLLLLVVAAFYCMRRKGRPGCCRRAEKGAPPAREPELSHSGSERPEHT
GLLMGGPSGGGRGGSGGFGDEC
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggaaccccctgacgcccgcgcagggctgctgtggctcaccttcctgctgtcgggctac
tcaggtgcccaggctgagctgcacgtgtccgtgcccccacgggtggaggtgatgcgaggc
gagcaagtcgccctggactgcactccacgggagcaccctgagcattacgtgctggaatgg
ttcctcgttgatggtactggggctcgacaccgtctggcttctgtggaaccacagggctca
gagttcctgggcacagtccactctctgggccgcgtacccccatacgaggtagactctcgt
gggcgcctggtgatagcaaaggtccaggtgggcgatggacgggactacgtgtgcgtagtg
aaggctggggcagcgggtacctcagaggccacctcaagtgtccgtgtgtttgcaacacca
gaggatacggaggtgtctcccaacaaagggacgctgtctgtgatggaccagtttgcccag
gagattgccacctgcagcagcaacaacggaaaccccgtgcctcggatcacatggtaccga
aacgggcagcgtctggaagtacccatggaggtgaaccaaaagggctacataaccatccgt
actgtccgggaagcctcaggcctgtactccctgaccagcaccctctacctgaggctgcac
aaggatgatcgggatgccaacttccactgtgctgctcactacgacttgccctcaggccaa
catggccgcctggacagccatacctttcgcctcaccctgcactatcccacggaacatgta
gaattctgggtggggagcccgtccaccacggagggctgggtccgtgagggtgatgctgtc
cagctgctctgccagggcgatggcagccccagcccagagtattcttttttccgccagcag
ggtacccaggaggaacagctgaatgtcaacctcaagggaaacttgaccctagaacgggtg
catcggaaccagagcgggatctacggctgcagagtggaggattacgatgccgacgaggaa
gtgcaacttgtcaagaagctaaagctgcacgtggcctacctggatccattggagctgagc
gtgcctgaggagctcttcgtattcctgaacagcagcagcacggtggtgaactgctccgct
agaggcctgcctactcctactgtgcgatggaccaaggattctgtgacccttgcagacggc
cccatgctctctctccagtctgtgacctttgactcagctggcacctatacctgtgaggcg
tccacacccacagtccccctcctgagccgcacacagagtttccagctcatcgtccaagga
gcaccagagttaaaaccgaatgagataatgcccaaatcagggaatagctggacagaaggc
gatgaagtcatgctgacctgctccgcccggggcttcccagagcccaaactcacctggagt
cagcgaggcgatactccagcagagccgccctttgagggtagaggctggaagagcagctcg
ctgatggtgaaagtgaccagcgccctgagccgagagggcgtgtcctgtgaagcgtctaac
atccatggcaagaaaggccatgtcttccactttggctctgtggcccctcagactgcccag
gctggagtggctgtcatggctgtagctgtcagcgtcggtcttttgctactcgtggtcgct
gctttctattgcatgagacgcaaagggcgccctggctgctgccggcgagcagagaaaggg
gcgccgccagccagggaaccggagttgagccactctgggtcagagcggccagaacacacg
ggccttctcatgggtgggccctccggaggaggcagaggtggcagtggaggctttggagat
gagtgttga

DBGET integrated database retrieval system