KEGG   Mus musculus (mouse): 57279
Entry
57279             CDS       T01002                                 

Gene name
Slc25a20, 1110007P09Rik, C78826, CAC, Cact, mCAC
Definition
(RefSeq) solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20
  KO
K15109  solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    57279 (Slc25a20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    57279 (Slc25a20)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   57279 (Slc25a20)
SSDB
Motif
Pfam: Mito_carr Polysacc_synt_3
Other DBs
NCBI-GeneID: 57279
NCBI-ProteinID: NP_065266
MGI: 1928738
Ensembl: ENSMUSG00000032602
Vega: OTTMUSG00000050670
UniProt: Q9Z2Z6
Position
9; 9 F2
AA seq 301 aa
MADEPKPISPFKNLLAGGFGGMCLVFVGHPLDTVKVRLQTQPPSLSGQPPMYSGTLDCFR
KTLMREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPEDELSYPQLFTAGMLS
GVFTTGIMTPGERIKCLLQIQASSGENKYSGTLDCAKKLYQEFGIRGFYKGTVLTLMRDV
PASGMYFMTYEWLKNLFTPEGKSVSDLSVPRILVAGGFAGIFNWAVAIPPDVLKSRFQTA
PPGKYPNGFRDVLRELIREEGVTSLYKGFNAVMIRAFPANAACFLGFEIAMKFLNWIAPN
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atggcagacgagccgaaacccatcagtccgtttaagaacctcctggctggcggcttcggc
ggcatgtgcctggtgtttgtggggcaccccctggacacggtcaaggtccgactgcagaca
caaccaccaagtttgtctggacagccacctatgtactctgggaccttggactgtttccgg
aagactcttatgagagagggcatcacagggctgtatcggggcatggctgcgcccatcatt
ggagtcacccctatgttcgccgtgtgcttctttgggtttggtctggggaagaaactacag
cagaaatctccagaggatgaacttagctacccacagctgtttacagctgggatgttatct
ggtgtgttcaccacaggaatcatgacccctggagaacggatcaaatgcttactgcagatt
caggcttcttcaggggagaacaagtacagtggcaccttggactgcgcaaagaagctgtat
caggagttcgggatccgcggcttctacaaagggactgtgctcacactcatgcgagatgtt
cctgccagtgggatgtatttcatgacatatgaatggcttaaaaatctcttcactccagag
ggaaagagtgtcagtgacctcagcgtgcctcggatcctggtggctggtggctttgcaggg
atcttcaactgggccgtggcaatccccccggacgtgctcaagtctcgattccagactgca
cctcctggaaaatatcctaatggtttcagagatgtgttgagagagctgatccgagaagaa
ggagtcacctccttgtacaaagggttcaatgcagtcatgatccgcgccttcccagccaac
gctgcctgtttccttggctttgaaattgccatgaagttccttaattggattgcccccaac
ttgtga

DBGET integrated database retrieval system