KEGG   Mus musculus (mouse): 57295Help
Entry
57295             CDS       T01002                                 

Gene name
Icmt, 1700008E11Rik, C80758, Gm13095, HSTE14, PPMT, STE14, pcCMT
Definition
(RefSeq) isoprenylcysteine carboxyl methyltransferase
  KO
K00587  protein-S-isoprenylcysteine O-methyltransferase [EC:2.1.1.100]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    57295 (Icmt)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.100  protein-S-isoprenylcysteine O-methyltransferase
     57295 (Icmt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICMT PEMT DUF1295
Motif
Other DBs
NCBI-GeneID: 57295
NCBI-ProteinID: NP_598549
MGI: 1888594
Ensembl: ENSMUSG00000039662
Vega: OTTMUSG00000010407
UniProt: Q9EQK7 Q3U4N2
Position
4; 4 E2
AA seq 284 aa AA seqDB search
MAGCAARVPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYR
PPRYQIAIRACFLGFVFGCGVLLSFSQSSWNHFGWYVCSLSLFHYSEYLVTAVNNPKSLS
LDSFLLNHSLEYTVAALSSWIEFTLENIFWPELKQITWLSATGLLMVVFGECLRKAAMFT
AGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWFYWSIGTQVMLCNPICGVVYALTV
WRFFRDRTEEEEISLIHFFGEEYLDYKKRVPTGLPFIKGVKVEL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctgcgcggcgcgggttccgccgggctccgaggcgcgcctcagcctcgctaca
ttcctcctgggcgcctcggtgctcgctctgccgctgctcacgcgcgccggcctgcagggc
cgcaccgggctggcgctctacgtggccggactcaacgcgctgctgctgctactctaccgg
ccgccgcgctaccagatagccatcagagcttgtttccttggctttgtgtttggctgtggt
gtgctgctaagtttcagccagtcctcttggaatcactttggctggtacgtgtgctcgctg
tctctgttccactattctgagtacttagtgacagctgtcaataaccccaaaagtctgtcc
ctggactccttcctcctgaatcacagcctggagtacacggtagctgccctgtcttcttgg
atagagttcacgctcgagaacatcttctggccagaactgaagcagattacctggctgagt
gccaccgggctcctgatggtggtcttcggagaatgcctgaggaaagctgccatgtttacg
gctggctccaacttcaaccatgtggtgcagagtgaaaagtcagacacccacactctggtg
acaagtggggtgtatgcttggtgccggcacccctcctatgtgggctggttttactggagt
atcggaacccaggtgatgctgtgtaatcccatctgtggcgtggtctatgccctgacggtg
tggcgcttcttccgagatcgcacagaagaggaggagatctcactgattcacttttttggg
gaagagtacttggattataaaaagagggtgcccacaggcctgcctttcataaagggggtc
aaggtggagctatga

DBGET integrated database retrieval system