KEGG   Mus musculus (mouse): 57296Help
Entry
57296             CDS       T01002                                 

Gene name
Psmd8, 6720456J22Rik, AA407360, AL033291, AL033322, AL033323, C76433
Definition
(RefSeq) proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
  KO
K03031  26S proteasome regulatory subunit N12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    57296 (Psmd8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    57296 (Psmd8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    57296 (Psmd8)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     57296 (Psmd8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSN8_PSD8_EIF3K
Motif
Other DBs
NCBI-GeneID: 57296
NCBI-ProteinID: NP_080821
MGI: 1888669
Ensembl: ENSMUSG00000030591
Vega: OTTMUSG00000043396
UniProt: Q9CX56 Q9CPS5
Position
7; 7 B1
AA seq 353 aa AA seqDB search
MFIKGRAAKTPRGEPRRSSRGGRKLAVVAPPPVLGSTSRPHFRRESIARRRCRKSGRRLA
ASRKMAATAATVNGSTTVSSSGPAATSVGILQAAAGMYEQLKDEWNRKNPNLSKCGEELG
RLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFD
YKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLM
EGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPK
KMTDYAKKRGWVLGPNNYYSFASQQQKPEDSTIPSTELAKQVIEYARQLEMIV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgttcattaagggtcgggctgcgaagacaccccgaggagagccgcggcgctcctcccgc
ggggggcggaaactggcagtggtagctccgcctccagttttgggctccacctcccggcct
catttccgccgggagtccattgcccggcgtcgctgccgtaagtcgggtcggcggcttgcc
gcatcacggaagatggcggccacagcggctacggtgaacgggtcgaccaccgtctcgagc
tccggacccgcggccacctcggtcgggatcctgcaggcagcggccggcatgtacgagcaa
ctcaaggacgagtggaaccggaagaacccgaaccttagtaaatgtggagaagaactgggc
cgcctgaagttggttctgcttgagctcaatttcctgccaaccacggggaccaaactgact
aaacagcaactcattctggcccgtgacattctggagatcggggcccagtggagcatcctg
tgcaaagacattccctccttcgagcgctacatggcccaactcaaatgctactactttgat
tacaaagaacagcttcctgagtcagcctatatgcaccagctcctgggcctcaatctcctc
ttcctgctatctcagaaccgagtggctgagttccacacagaattagaacgattacctgcc
aaggacatccagaccaatgtctacatcaaacaccctgtttccctcgagcaatacctcatg
gagggtagctacaacaaggtattcctggctaaggggaacatccctgccgaaagctacacc
ttcttcattgacatcctgctggataccatcagggatgaaatcgcaggatgcattgagaag
gcctatgagaaaatcctttttgctgaggctacccggatcctcttcttcagcacacccaaa
aagatgacagactatgccaagaagcgaggttgggtgctgggccctaacaactactacagc
tttgccagccagcagcagaagccagaagacagcaccatcccctctactgaactggccaaa
caagtcatcgagtatgcccggcagctggagatgattgtctga

DBGET integrated database retrieval system