KEGG   Mus musculus (mouse): 57316
Entry
57316             CDS       T01002                                 

Gene name
C1d, 1110036E10Rik, AI875855, SUN-CoR
Definition
(RefSeq) C1D nuclear receptor co-repressor
  KO
K12592  exosome complex protein LRP1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    57316 (C1d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    57316 (C1d)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Exosome cofactors
     57316 (C1d)
SSDB
Motif
Pfam: Sas10_Utp3
Other DBs
NCBI-GeneID: 57316
NCBI-ProteinID: NP_001317578
MGI: 1927354
Ensembl: ENSMUSG00000000581
Vega: OTTMUSG00000005196
UniProt: O35473
Position
11; 11 A3.1
AA seq 141 aa
MAGEEMNEDYPVEIHESLTALESSLGAVDDMLKTMMAVSRNELLQKLDPLEQAKVDLVSA
YTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAAKLDRGAASRFVKN
ALWEPKAKSTPKVANKGKSKH
NT seq 426 nt   +upstreamnt  +downstreamnt
atggcaggtgaagaaatgaatgaagattatcccgtagaaattcacgagtctttaacagcc
ctggagagctccctgggtgctgtggacgacatgctgaagaccatgatggctgtttctaga
aacgagttgttgcagaagttggacccattggaacaagcaaaggtggatttagtttctgca
tacaccttaaattcaatgttttgggtttatttggcaactcaaggagttaatcccaaagag
catccagtgaagcaggaactggaaagaatcagagtctacatgaacagagttaaagaaata
acagacaagaagaaggctgccaagctggacagaggtgctgcttcgagatttgtcaagaac
gcactctgggaacccaaagcaaaaagcacaccaaaagtggctaataaagggaaaagcaaa
cactaa

DBGET integrated database retrieval system