KEGG   Mus musculus (mouse): 57339
Entry
57339             CDS       T01002                                 

Symbol
Jph1, JP-, JP-1, Jp1
Name
(RefSeq) junctophilin 1
  KO
K19530  junctophilin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    57339 (Jph1)
SSDB
Motif
Pfam: MORN
Other DBs
NCBI-GeneID: 57339
NCBI-ProteinID: NP_065629
MGI: 1891495
Ensembl: ENSMUSG00000042686
Vega: OTTMUSG00000048149
UniProt: Q9ET80
Position
1; 1 A3
AA seq 660 aa
MTGGRFDFDDGGTYCGGWEEGKAHGHGICTGPKGQGEYSGSWSHGFEVVGVYTWPSGNTY
QGYWAQGKRHGLGVETKGKWMYRGEWSHGFKGRYGVRQSLCTPARYEGTWSNGLQDGYGV
ETYGDGGTYQGQWAGGMRHGYGVRQSVPYGMATVIRSPLRTSLASLRSEQSNGSVLHEAA
AAAADSPAGTRGGFVLNFHADTELGKKKGGLFRRGSLLGSMKLRKSESKSSISSKRSSVR
SDAAMSRISSSDANSTISFGDVDCDFCPVEDHVDATTTETYMGEWKNDKRNGFGISERSN
GMKYEGEWANNKRHGYGCTVFPDGSKEEGKYKNNILVRGIRKQLIPIRNTKTREKVDRAI
EGAQRAAAMARTKVEIANSRTAHARAKADAADQAALAARQECDIARAVARELSPDFYQPG
PDYIKQRCQEGGDIKENPEEKVLEKPPSPKESPHFYRKGTTPPRSPESSPKQSHSPQPSS
PEPSKKQNPSPGARLSQDKQSLAEEQVTAFVNKPSMSKAPAKELGASVSKYSGRHHVPNP
SNGELHSQYHGYYVKLNTPQHPPEDREDDRGVSQSSSALVPRPSPNKWGPPKSVTKPVAK
ESKTEPKAKKSELAIPKNPASNDTCPSLEKEANSGPNSIMIVLVMLLNIGLAILFVHFLT
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgacgggcggaaggttcgacttcgacgatggcggcacctactgcggcggctgggaggag
ggcaaggcgcacgggcatggcatctgcacggggcccaagggccagggcgagtactctggc
tcctggtcgcacggcttcgaggtggttggagtctacacctggcccagcggcaacacctac
cagggctactgggcgcagggcaagcggcacgggctgggggtggagacgaagggcaagtgg
atgtaccggggggagtggtcacatggtttcaaggggcgctacggggtccggcagagcttg
tgcacccccgcccgctacgaggggacctggagtaacgggctgcaggacgggtacggcgtg
gagacctacggggatggaggtacctaccagggccagtgggctggaggcatgcggcatggc
tacggtgtccgccagagtgtgccctatggcatggccacagtgatccgttccccgctgcgc
acttccctggcctcgctgcgcagtgagcagagcaacggcagcgtgctgcatgaagctgca
gccgcagctgcagacagcccggctggaacaagaggtggcttcgtgctcaacttccatgcg
gacacggaactgggcaagaagaagggcggcctcttccgtcggggttcccttctcggcagc
atgaaactccgcaagtccgaatccaagtcttccatctccagcaagcgcagctcggtccgc
agtgatgcagccatgagcagaatcagttctagcgatgccaactccaccatcagctttggt
gacgtcgactgtgatttttgccccgtggaagatcacgtggatgccactaccacggaaacc
tacatgggcgagtggaagaacgataagcgcaatggcttcggcatcagcgaacgctccaat
ggcatgaagtacgaaggcgagtgggccaataacaagaggcatgggtacggctgcactgtg
tttcctgatggctccaaagaagagggaaaatacaaaaataatatcctggtccgtgggata
aggaagcagcttataccaataagaaatacaaaaactagagagaaggtggatagagcaatt
gaaggtgcacaaagggcggcagccatggccagaaccaaagtggaaatagcaaactcaagg
actgcacatgccagagcaaaagctgatgctgccgaccaagctgcactggctgctcgccag
gagtgcgacatagcaagagctgtggccagagagctgtcacctgatttctaccaaccaggc
cccgattatatcaaacaaagatgtcaggaagggggagatattaaagaaaatccagaagaa
aaggtcctagaaaagcctccgtcaccaaaggaatctcctcatttttatcgcaaaggcacc
acaccccccaggtctcctgagtcaagtcccaaacagagccactctccccagccttcctcc
ccagagccctcaaagaaacaaaaccccagcccaggggcaagactcagtcaagataaacag
agcctagctgaggaacaagtgacagcctttgtcaataaaccctctatgtcaaaggctccc
gcaaaagaattgggagcatctgtgtccaagtactctggccgccaccatgtccccaacccc
agcaacggggagctgcactctcagtatcacggctactatgtgaaactgaacacaccccag
catcctccagaagacagggaggatgacagaggagtcagccagtcttcctcagcattggta
cctagaccatcacctaacaagtggggtccccctaaatctgtgacaaaaccagttgccaaa
gaaagcaaaactgagccaaaagcaaagaagtctgaacttgctataccaaagaatccagca
agcaatgatacctgcccttccttggaaaaagaagccaactctggccctaattccatcatg
attgtcctggtcatgctgttgaatattgggttggccattctttttgttcactttctgact
tga

DBGET integrated database retrieval system