KEGG   Mus musculus (mouse): 57340
Entry
57340             CDS       T01002                                 

Symbol
Jph3, JP-, JP-3, Jp3
Name
(RefSeq) junctophilin 3
  KO
K19530  junctophilin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    57340 (Jph3)
SSDB
Motif
Pfam: MORN Phage_holin_6_1
Other DBs
NCBI-GeneID: 57340
NCBI-ProteinID: NP_065630
MGI: 1891497
Ensembl: ENSMUSG00000025318
Vega: OTTMUSG00000036743
UniProt: Q9ET77
Position
8; 8 E1
AA seq 744 aa
MSSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLGVYTWPSGNT
YQGTWAQGKRHGIGLESKGKWVYKGEWTHGFKGRYGVRECTGNGAKYEGTWSNGLQDGYG
TETYSDGGTYQGQWVGGMRQGYGVRQSVPYGMAAVIRSPLRTSINSLRSEHTNGAALHPD
ASPAVAGSPAVSRGGFVLVAHSDSEILKSKKKGLFRRSLLSGLKLRKSESKSSLASQRSK
QSSFRSEAGMSTVSSTASDIHSTISLGEAEAELAVIEDDIDATTTETYVGEWKNDKRSGF
GVSQRSDGLKYEGEWVSNRRHGYGCMTFPDGTKEEGKYKQNVLVSGKRKNLIPLRASKIR
EKVDRAVEAAERAATIAKQKAEIAASRTSHSRAKAEAALTAAQKAQEEARIARITAKEFS
PSFQHRENGLEYQRPKHQMSCDDIEVLSTGTPLQQESPELYRKGTTPSDLTPDDSPLQSF
PASPTSTPPPAPASRTKMAHFSRQVSVDEERSGDIQMLLEGRGGDYARNSWGEEKAGASR
GIRSGALRSGQPTEDFRTRGSGHKQPGNPKPRERRTESPTTFSWTSHHRAGNPCSGGPKL
LEPDEEQLSNYKLEMKPLLRMDACPQDTHPQRRRHSRGAGGDRGFGLQRLRSKSQNKENL
RPASSAEPTVQKLESLRLGDRPEPRLLRWDLTFSPPQKSLPVALESDEETGDELKSSTGS
APILVVMVILLNIGVAILFINFFI
NT seq 2235 nt   +upstreamnt  +downstreamnt
atgtccagtgggggtaggtttaattttgacgatggagggtcctactgcggaggctgggag
gacggcaaggcgcacggccatggcgtctgcaccggcccgaagggccagggcgaatacacc
ggctcgtggagccacggctttgaggtgctgggcgtctacacctggccaagcggcaacacg
taccaaggcacctgggcgcagggcaagcgccacggcatcggcctggagagcaaggggaag
tgggtgtacaagggcgagtggacgcacggatttaaggggcgctacggggtgcgggagtgc
acgggcaacggagccaaatacgaagggacctggagcaacggactgcaggatggctacggc
acggagacctactcggatggaggaacgtatcagggccaatgggttggtggcatgcgccag
ggctacggtgtgcggcagagtgtcccttatggcatggccgcagtcatccgttcgcccctg
aggacctccatcaactccctgcgcagcgagcacaccaacggggcggcactgcacccggac
gcctccccggcagtggccggcagtccggccgtgtcccgtggtggcttcgtgctggtggcc
cacagtgactcggagatcctcaagagcaagaagaagggactgttccggcgctcgctgctg
agcggcctgaagctacgcaagtctgagtccaagagcagcctggccagccagcgcagcaag
cagagctccttccgcagcgaggccggaatgagcaccgtgagctccacggccagcgacatc
cactccaccatcagcctgggcgaggccgaggctgagctggcggtcattgaggacgacatc
gacgccactaccaccgagacctacgtgggtgaatggaagaacgacaaacgctcgggcttc
ggtgtgagccagcgctcggacgggcttaagtatgagggcgagtgggtcagcaaccgccgg
catgggtacgggtgcatgactttccccgacggcaccaaggaggaggggaagtacaagcag
aacgtgctcgtgagcggcaaacgcaagaatctcatcccgctgcgtgccagcaagatccgg
gagaaggtggaccgggccgtggaggcagccgagagggcggccaccatcgccaagcagaaa
gccgagatcgctgcgtccaggacctcccactcacgggccaaggctgaggcagcacttact
gcggctcagaaagcccaggaggaagcgcggatcgccaggatcactgccaaagagttctct
ccctccttccagcacagggaaaacgggcttgagtaccagaggccaaagcaccagatgtcc
tgcgatgatatcgaggtgctctccaccgggacacccctacagcaggagagccccgagctg
taccgaaagggcaccaccccttctgatctgacccctgacgacagtcccctgcagagcttc
cccgccagccccacatctacccctccgccagctcctgcctccaggaccaagatggcccac
ttctccaggcaggtctccgtggacgaggagcgaagcggggacatccagatgctcctcgag
ggccgcggaggggactatgcccgcaacagctggggcgaggagaaggctggggcctctagg
ggtatccgcagcggtgccctacgcagcggccagcccactgaggacttccgcacccggggc
tcaggccacaagcagcctgggaaccccaagccccgggagcggcggacggagtcccccacc
acgttctcatggacttcccaccaccgggcaggcaatccctgttctgggggccccaagctg
ctagagccagatgaggagcagctgagcaactacaagctggagatgaagcccttactgagg
atggatgcctgtccacaggatacgcacccacagagacggcgtcatagccggggtgctggg
ggggacaggggcttcgggctacagagactgaggtccaagtcccaaaacaaggagaacctt
aggccagcctcctctgcagaacccacggtgcagaaactcgagagcctgcggctgggggac
cggcccgagccccgtctgctgcgttgggacctgaccttctccccaccccagaagtccctg
cctgttgcactcgagtctgacgaggagactggagatgagctcaagtccagcacgggctca
gctcccatcttggtcgtcatggtgatcctgctcaacattggagtcgccattttgtttatt
aactttttcatctga

DBGET integrated database retrieval system