KEGG   Mus musculus (mouse): 57354
Entry
57354             CDS       T01002                                 

Gene name
Cramp1l, 5830477H08Rik, AI256853, AI790734, Cramp1, Tce4, mKIAA1426
Definition
(RefSeq) cramped chromatin regulator homolog 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Myb_DNA-bind_7 Myb_DNA-binding
Other DBs
NCBI-GeneID: 57354
NCBI-ProteinID: NP_065633
MGI: 1930190
Ensembl: ENSMUSG00000038002
UniProt: Q6PG95
Position
17; 17 A3.3
AA seq 1285 aa
MTVKLGDAGSGEEGLKKLGKRTADEESLDGEGPGGADAADSSSTKRDGQTPRASGAPAPP
RGLPTPSPPQGSPQDQHHFLRSSVRPQSKRPRKDAPCALGSGGASGSGPRGKGSDGGASS
SGNVSGATPATPAGGSRSSSRNIGSSGPEKEEGKKVRRQWESWSTEDKNTFFEGLYEHGK
DFEAIQNNIALKYKKKGKPASMVKNKEQVRHFYYRTWHKITKYIDFDNVFSRGLKKSSQE
LYGLICYGELRKKIGGCMDDKNATKLNELIQVGATTVRYKGRNLRIKAPMCRALKKLCDP
DGLSDEEDQKPVRLPLKVPVELQPRNNHAWARVQSLAQNPRLRMIVELHRKVSSLIEFLK
QKWALHEVRIRKTLEERQLQGSSTVQTQEKVALHLFPGENCTLTPLPGVARVVHSKAFCT
VHWQEGGRCKQGTKDIHSLPPAQILGIQSGQGIARGQLKCQRSSAEGKGGGRLLPTADAS
QSSGESSPESAPAEGAAPSLSSPDAPDRPHGLQDSGPHLEKTPVTALAVGRDSPIQESGA
LPCPCGQPPDLEDELSLLDPFPRYLKSCQDLIIPEQCRRADTRSGREHPPLGSVASPETL
TPSSGAVADSAPPGLDPQPGTDHQPDTRLQSDICTKELANASSEESQEKGSPSEHLSSQG
QPATRPSKEVPASQLAQQLREEGWSLQTSESLTLAEVYLMMGKPTKLQLEYDWLAVLGPE
SQAPTAQGQTALSRSSPSALHQQRLLSCLLRLISTEVHPKMAFEANTASTASVRPTQEEQ
STTPPGKVVTINSRSPRCSRNPSTLRSNKTFPSASAPCSPGLRNPPRPLLVAGPSSTGSS
DSDGGLFAVPTTLPPNSRHGKLFSPSKEAELTFRQHLDSISIQSDFFSPKPKKLRKRHLR
KPLVVQRTLLPRPSENQSHNVCSFSILSNSPIAGRGWFRPIQSSLTKAALSRPIVPKVLP
SQATSHLPSAIDLAAQSAGIIPGSPLPILDTDGSSGISPLSSEQATTAISGQGDTGPHQN
RDPVTAVRGTNDPFISVTRPEQEPMTDGFQGSPALTLPELSKANLQNGLSIPLPSSESSS
TRLSPPNVSALLDISLPGPPEDVLSQGEPATQISDSIIEIAISSGQYSEGVPLSPAKLNG
SDSSKSLPSPSSSPQPNWIASPTHDPQWYPSDSADSSLSSLFASFISPEKSRKMLPTTVG
ANSGTSLLGPSLLDGNSRDSFVSRSLADVAEVVDSQLVCMMNENSIDYISRFNDLAQELS
ITEPGRREVLFDGGGGGNPVGDLSQ
NT seq 3858 nt   +upstreamnt  +downstreamnt
atgacagtgaagttgggcgacgccggcagcggggaggaagggctcaagaagctgggcaag
cggacggccgatgaggagtcgctggacggagaggggcccggcggcgcggacgcggcggac
agcagcagcacaaagagggacgggcagacccctcgggcctccggagcccccgcgccaccc
agagggctgccgaccccgtctccaccgcagggcagcccccaggaccagcaccatttccta
aggtccagcgtgcgaccccagagcaagaggcccaggaaggacgcaccctgtgctttgggc
agtggtggtgccagcggttccgggccgcgaggaaaaggaagtgacggtggtgcatcatct
tctggaaacgtgtctggggctacccctgccactcctgcaggaggctcgcgctcctcctcc
cggaacataggatcttcagggcctgagaaagaagaaggaaagaaggtccgaaggcagtgg
gagtcgtggagcaccgaggacaagaacaccttcttcgagggactgtatgagcatggaaaa
gactttgaagccattcagaacaacattgctctaaagtacaagaagaagggcaagcctgca
agcatggtgaagaacaaagagcaggtccggcatttttactaccgcacctggcacaagatt
accaaatacattgactttgacaatgtgttctctcgagggctgaagaagtcatcccaggaa
ctctatggtctcatctgctatggcgagctacgcaagaagattgggggttgtatggatgac
aagaatgcaacaaagttgaatgaactcattcaggttggagccaccacagtacgttataaa
gggagaaatctccggatcaaggcacccatgtgccgagccctaaagaaactctgtgatcca
gatggtctaagtgatgaagaggaccagaagccagtgcgcctacccctgaaagtcccagta
gaattacaaccaaggaacaaccacgcttgggcacgagtacagagcctggcccagaaccca
cgtctcaggatgattgtggagctacatagaaaagtctctagcctcattgagttcctgaag
cagaagtgggcactccatgaagtacgaattcggaagacacttgaggagaggcagctgcag
ggttcaagcacagtgcagacccaggagaaggtggcattgcacctgttcccaggcgagaac
tgcacgctgacaccactacccggtgtagcccgtgtggtacactccaaggccttctgcact
gtacactggcaagagggtggccggtgcaaacagggcactaaggacatacactcactgcct
ccagcacagatcctcggcatccagagtggacagggaatagcccggggccagctgaagtgc
cagaggagcagtgctgaaggcaagggtggggggcggctccttcccactgcagatgcttca
cagagctcaggggaaagttcccctgagagtgctcctgcagagggagcagctccaagtctg
agcagcccagatgcccccgacaggcctcatgggctccaggactctggaccacaccttgag
aagacccctgtgacagcccttgcagtgggtagggacagccctattcaagaatctggggcc
ctgccgtgtccctgtggccagcccccagacttggaagatgaactctcactccttgacccc
ttcccccgatacctgaagtcgtgccaggatctcatcatcccagagcagtgccgccgtgca
gacacacgatctgggagagagcatcctcctctcggcagcgtagcttccccagagaccctc
acacccagcagcggggcggtcgctgacagtgctccccctggcctggaccctcaacctggc
actgatcatcaacctgacaccaggcttcagtcagatatttgtactaaagagctagcgaac
gcatcctctgaagagtcccaggaaaaaggcagcccctcagaacatctgtcgtctcaggga
cagcctgctaccaggccttccaaggaagtccctgccagccagctggcccagcagctacgt
gaagaaggctggagcttgcagacctctgaaagcctcacactggctgaagtctacctcatg
atgggcaagccgaccaaactgcagctggagtatgattggctggctgtgctgggccccgag
agccaggcacccacagcacagggccagactgcactatcccgctcctcgccctcagccctc
caccagcaacgcctcctgagctgccttctgaggctcatctccactgaggtccaccccaag
atggcttttgaagcaaacacagcatcaacggcttcagtcaggcccacccaggaggaacag
tccacaactccaccagggaaggtagtgaccatcaactctcggagtccccgctgttctcga
aacccatctaccctccgaagcaacaagactttcccatctgcttctgccccttgctcccca
ggtttgagaaaccccccaaggcctctcttggtggctggtccctccagcacaggaagcagt
gactcagatggtggcctctttgctgtcccaacgactttgccaccaaatagtcgacatgga
aagctcttctctcccagtaaggaggcggagctgacttttcggcagcacttggactccatc
agcatacagtcagactttttctcaccaaagcccaagaaactacggaaacggcacttaaga
aagccactggtggtccagaggacactgctccctagaccttctgaaaaccagtcccacaat
gtgtgctccttctccatcctgtctaactctcctatagctgggagaggctggttccggccc
atccagtcttctttgaccaaagcagctctgtctcgaccgatagtgcccaaggtcctccca
tctcaggccaccagtcacctgcccagtgccatcgacttagcagctcaaagtgctggcatc
atccctggaagtcccttgccaattttagatactgatggctcatctggcatctctccactg
tcttcagaacaagcaaccactgccatctcggggcagggtgacactggaccacaccagaac
agagaccctgttactgctgtaaggggcactaatgacccatttatcagtgttacaagacca
gagcaggagccaatgacagatggtttccagggatcacctgctctgaccttacctgagctg
tccaaggctaatctccagaatggcctgtccatacctttaccctcatcggagagctccagc
acccgtctctccccacccaatgtttctgcactgctggacatatccctacctggtccacct
gaggatgttctctcacagggagaacctgccacacagatcagtgactccatcattgaaatt
gccatcagctctggccagtacagtgaaggagttcccctttctccagcaaaactgaacggc
agtgacagttccaagagtcttccctccccatctagcagcccccagcccaactggattgcc
tctcccactcatgatccccagtggtatcccagtgactctgcagattcctcactcagcagc
ttgttcgccagcttcatatctccagagaagagcagaaagatgctaccaactactgttggg
gccaacagcggcacatctttgcttggccctagcttgttggatggaaattcaagggactct
tttgtgtccaggtctctggctgatgttgcagaagtggtggattcccagttggtgtgcatg
atgaacgagaacagcattgactacatatctcggtttaatgacctggcccaagaattgtcc
atcactgagcctggccgccgggaggttctttttgatggtggaggaggtggtaatcctgtt
ggtgacctctctcagtga

DBGET integrated database retrieval system