KEGG   Mus musculus (mouse): 57377
Entry
57377             CDS       T01002                                 

Gene name
Mogs, 1810017N02Rik, AI181835, Gcs, Gcs1
Definition
(RefSeq) mannosyl-oligosaccharide glucosidase
  KO
K01228  mannosyl-oligosaccharide glucosidase [EC:3.2.1.106]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    57377 (Mogs)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    57377 (Mogs)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    57377 (Mogs)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.106  mannosyl-oligosaccharide glucosidase
     57377 (Mogs)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   57377 (Mogs)
SSDB
Motif
Pfam: Glyco_hydro_63 Glyco_hydro_63N GDE_C
Other DBs
NCBI-GeneID: 57377
NCBI-ProteinID: NP_065644
MGI: 1929872
Ensembl: ENSMUSG00000030036
Vega: OTTMUSG00000024275
UniProt: Q80UM7
Structure
PDB: 
5MHF

Position
6; 6 C3
AA seq 834 aa
MARGERRRRAAAAEGARPLERARAAGRRDGRAGGARGSASGAALAVVVLALAFGLSGRWV
LAWLRVRRALTLHPAPSALPPDSSSPAVAPELFWGTYRPHVYFGMKTRSPKPLLTGLMWA
QQGATPGTPPKLRHTCEQGDGVGPYGWEFHDGRTFGRQHIHDGALRLTTEFVKRPGGQHG
GDWSWRVTVEPQASGTPSFPLVSLFFYVVTDGQEVLLPEIGAKGQLKSISGHTSELGDFR
LTLLPPTSPGDTVPKHGSYNVFWSSNPGLPQLTDMVKSRLNSWFQHRPPGASPDRYLGLP
GSLKWEERGPSGQGQFLIQQVTLKAPFSVEFVFESGSAATGGNQASGRLVGSQLTQALES
HAAAFKERFEKTFQLKEKGLSPEEQALGQVALSGLLGGIGYFYGQGLVLPDTSMEGSEQK
MDPALFPPVPLFSGVPSRSFFPRGFLWDEGFHQLVVQRWDPHLTREALGHWLGLLNADGW
IGREQILGDEARARVPPEFLVQRAAHANPPTLLLPVVHMLEGHDPDDLAFLRKAFPRLHA
WFSWLHQSQAGPVPLSYRWRGRDLALPTLLNPKTLPSGLDDYPRASHPSTAERHLDLRCW
VALGARVLSQLAEQLGETEAAAELGPLAASLEEPGSLDELHWAPELGVFADFGNHTKAVQ
LKSRPPQGLVRVVGRPPPRLQYVDALGYVSLFPLLLQLLDPSSPRLGPLLDVLADSRHLW
SPFGLRSLSASSLFYKQRNTEHDPPYWRGAVWLNINYLALGALHHYGHVEGPHKVQAAKL
YHELRANVVRNVRQQYQATGFLWEQYSDQDGRGMGCRPFQGWTSLVLLIMAEEY
NT seq 2505 nt   +upstreamnt  +downstreamnt
atggcccggggcgagaggcgacggcgcgctgcggccgcagagggggcgcggccgctggag
agggcgcgggcggcgggccggcgggatggcagggctggtggggcgcggggctcggcgagc
ggcgcggccctggccgtggtggtgttggcgctggccttcggcctgtcggggcgctgggtg
ctggcgtggctccgtgtgcgccgcgcgctcacactgcaccccgcgccgtctgcgctgccg
ccggactcctccagtcctgccgtggccccggaactcttctggggcacctaccgcccacac
gtctatttcggcatgaagactcgcagccccaaaccactgctcacaggactgatgtgggca
cagcaaggcgccaccccggggacccctcctaagctcaggcacacgtgtgaacagggagac
ggcgtgggtccctatggctgggagttccacgatggccgcaccttcggtcggcagcatatc
cacgatggggccttaaggctcaccactgagttcgtcaagaggcctgggggtcagcacgga
ggggattggagctggagagtgaccgtagagcctcaggcctcaggtacaccttccttccct
ttggtgtccctgttcttctacgtggtgacagatgggcaagaggtcctactaccagagatc
ggagccaaaggacagttgaagtccatcagtgggcacaccagtgaacttggtgacttccgc
ctcacacttctgccgccaaccagtccaggagacactgtccctaagcatggcagctacaat
gtcttctggtcctccaacccggggctgccacagctcacagatatggtaaagagccgccta
aacagctggtttcagcaccggcccccaggagcctctcctgaccgctacctcggcttgcct
ggatctctgaagtgggaggagagaggccctagtgggcaagggcaattcttgatccagcag
gtgacactgaaagcccctttctctgtggagtttgtgtttgaatctggcagtgcggcaaca
ggaggaaaccaagcctctgggcggctggtaggcagccaactgacccaggccctggagagc
catgctgcagccttcaaggaacggtttgagaagaccttccagctaaaggagaagggcttg
agtcccgaggaacaggctttgggtcaggttgccctcagtggccttcttggtgggattggt
tacttctatggacagggtttagtgttgccagacactagcatggaagggtctgaacagaaa
atggaccctgccctgtttccacctgtccctcttttctctggggtgccttctaggtcattc
ttcccacgaggcttcctctgggatgaaggctttcaccagctagtggtccagcgatgggat
ccccacctcacccgggaggccctaggacactggctggggctgctcaatgctgacggctgg
attgggcgagagcagattctgggggatgaggccagagcccgagtgcccccagaattccta
gtgcaacgggcagcccatgccaaccccccaaccctgctcctgccagtcgtacacatgcta
gaaggccatgaccctgatgatttggcctttctccgcaaggctttcccccgcctgcatgcc
tggttctcttggctccatcaaagtcaggcagggccagtgccactatcctaccgctggcgg
ggcagggacctagctttgcctaccctacttaaccccaagacgctgccctcaggcctggat
gactaccctagggcctcgcatccttccacagcagagcggcacctggacctgcgctgctgg
gtggcactgggtgcccgggtgctgtcccagcttgcagaacagcttggggagactgaagct
gctgcagagctgggcccattggctgcctctctagaagaacctggaagtcttgatgagctg
cactgggctcctgagctgggggtctttgctgactttgggaaccacacaaaagcagtacag
ctcaagtcgaggcccccacaggggctggttagggtggtaggcaggcctccacctcgatta
cagtatgtggatgccctgggctatgtctctctttttcctttgctactacagctgctggac
cccagctcaccccgcttaggacccctgctagacgttctagctgatagtcgccatctctgg
agcccttttgggttgcgctctctttcagcctctagcctcttttataaacagcgtaacact
gagcacgatccaccctactggcgaggtgccgtgtggctgaatattaactacctagctttg
ggggcactacatcactatgggcatgtggagggtcctcacaaggttcaggctgccaaactc
taccatgaactgcgggccaatgtagtgagaaacgtccgccagcaataccaggctaccgga
tttctgtgggagcagtacagtgaccaggatgggcggggcatgggctgccgccccttccaa
ggatggaccagtcttgtcttactgatcatggctgaagagtactaa

DBGET integrated database retrieval system