KEGG   Mus musculus (mouse): 57385
Entry
57385             CDS       T01002                                 

Gene name
P2ry4, P2Y4, P2Y4R
Definition
(RefSeq) pyrimidinergic receptor P2Y, G-protein coupled, 4
  KO
K04271  P2Y purinoceptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    57385 (P2ry4)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    57385 (P2ry4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    57385 (P2ry4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    57385 (P2ry4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 57385
NCBI-ProteinID: NP_065646
MGI: 1926594
Ensembl: ENSMUSG00000044359
Vega: OTTMUSG00000018284
UniProt: Q9JJS7 Q0VBT7
Position
X; X C3
AA seq 361 aa
MTSADSLLFTSLGPSPSSGDGDCKFNEEFKFILLPLSYAVVFVLGLALNAPTLWLFLFRL
RPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGFCKFVRFLFYWNLYCSVL
FLTCISVHRYMGICHPLRAIRWGRPRFAGLLCLGVWLVVAGCLVPNLFFVTTNANGTTIL
CHDTTLPEEFDHYVYFSSTIMVLLFGFPFLITLVCYGLMARRLYRPLPGAGQSSSRLRSL
RTIAVVLTVFAVCFVPFHITRTIYYLARLLNAECRVLNIVNVVYKVTRPLASANSCLDPV
LYLFTGDKYRNQLQQLCRGSTPKRRTTASSLALVTLHEESISRWADIHQDSIFPAYEGDR
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaccagtgcagactccttgctattcacatcactaggtcccagcccaagttctggagat
ggtgattgtaagtttaatgaggaattcaagttcatcctgttgcctctgagctatgcagtt
gtctttgtgctgggcctggccctcaatgccccaaccctttggctgttcctcttccgcctt
cgaccctgggatgcaacagccacttacatgttccatttggcattgtcagacaccttgtat
gtgctgtcactgcccaccctcgtctactactatgctgccagaaaccactggccctttggc
actggcttctgcaagttcgtccgctttcttttctactggaacctctactgcagtgtcctt
ttcctcacctgcatcagtgtgcaccgctacatgggcatctgccatccactgcgggcaata
cgctggggccgccctcgatttgcaggtcttctctgcctaggtgtttggttggtagtagct
ggctgcctcgtgcccaacctcttctttgtgacaaccaatgccaatggaaccaccatcctg
tgccatgacacgactctgcctgaggagtttgaccactacgtatacttcagttccacaatc
atggtgctgctctttggctttcccttcttgatcactctggtctgctatggactcatggcc
cggcgactgtatcgacctttgccaggagctggacagtcatcttctcggctccgttctctc
cgcaccattgctgtggtgctgactgtctttgctgtctgctttgtgcctttccacatcacc
cgcacaatttattacctggcaagactgttgaacgccgaatgccgggtgctgaacattgtc
aatgtggtttacaaagtgactcgtcccctggccagtgctaatagctgtcttgatccagtg
ctctatctgttcacgggggacaagtatcgaaaccagctccagcagctatgcagaggtagc
acacctaagcgccgaacaactgcttcctccctggcattggtgaccctacatgaagaaagc
atcagcaggtgggcggacatccaccaagacagcatcttccctgcttatgagggtgaccga
ttataa

DBGET integrated database retrieval system