KEGG   Mus musculus (house mouse): 57432
Entry
57432             CDS       T01002                                 
Symbol
Zc3h8, AU020882, E130108N08Rik, Fliz1, Zc3hdc8
Name
(RefSeq) zinc finger CCCH type containing 8
  KO
K24388  zinc finger CCCH domain-containing protein 8
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    57432 (Zc3h8)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys3His zinc factors
    57432 (Zc3h8)
SSDB
Motif
Pfam: zf_CCCH_4 zf-CCCH_4 zf-CCCH zf-CCCH_2 Torus zf-CCCH_3 LAX
Other DBs
NCBI-GeneID: 57432
NCBI-ProteinID: NP_065619
MGI: 1930128
Ensembl: ENSMUSG00000027387
UniProt: Q9JJ48
Position
2:complement(128768188..128786018)
AA seq 305 aa
MDFENLFSKPPNPALGKKPAADPEERIDEIDGTEVEETQTEKVKWKVKRDREQIPKKFKH
LGNAATSPKSLLRKKSRSKDYDPYSDGETCSQGSEDNFDKELQQYIQAKEMANAAQPSLL
PEESVKKAGAEGTQQTAKQKNKKSKAGHKKVKQKKMKRKWPGTGDKGSRALLKNSGSREQ
TDEPEEKQPRVRMSQGFINQHTVERKGKQVCKYFLERKCIKGDQCKFDHDAEIEKKKEMC
KYYVQGYCTKGENCLYLHSEYPCKFYHTGTKCYQGDHCNFSHAPLTAETQELLAKVLDTD
KKSCK
NT seq 918 nt   +upstreamnt  +downstreamnt
atggattttgaaaatctcttttcaaagccccccaatccggccctcggcaaaaaaccggcc
gccgaccctgaggaaagaattgatgaaatagatggtactgaagttgaagaaacacagaca
gagaaagtcaaatggaaagtaaaacgggaccgtgaacaaattcccaagaaatttaagcac
cttggaaacgctgcaacatcaccaaagagtttgctacgtaaaaaatcaagaagtaaggac
tatgacccatatagtgatggtgagacatgcagccaggggtcagaagataactttgacaaa
gagcttcaacagtacatacaagccaaagaaatggcaaacgcagctcaaccctcattactt
cctgaagagtctgtgaagaaagcaggagcagaaggtacccagcagactgctaaacaaaaa
aataaaaaatctaaagctggtcacaagaaagttaaacagaagaaaatgaagcgaaagtgg
cctggcactggagacaaagggtcaagggccttgctgaagaacagtggctcccgggaacag
actgatgaacctgaagagaagcagccacgtgtgaggatgagtcaaggctttatcaaccag
cacacggtggaacgcaaagggaagcaagtttgcaaatatttccttgaaaggaaatgtatt
aagggagaccagtgtaagtttgatcatgatgcagagatagagaagaaaaaggaaatgtgt
aagtattatgtacaaggatattgtaccaaaggagagaactgcctgtatttacatagtgaa
tacccttgcaagttttatcacacaggaaccaaatgttatcagggcgatcactgtaatttt
tctcacgccccgctgactgcggaaacacaagaactattggctaaagttttggatactgac
aagaagtcatgtaaatag

DBGET integrated database retrieval system