KEGG   Mus musculus (mouse): 57435
Entry
57435             CDS       T01002                                 

Gene name
Plin4, S3-1, S3-12, mKIAA1881
Definition
(RefSeq) perilipin 4
  KO
K20254  perilipin-4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    57435 (Plin4)
SSDB
Motif
Pfam: Perilipin Antimicrobial_2
Other DBs
NCBI-GeneID: 57435
NCBI-ProteinID: NP_065593
MGI: 1929709
Ensembl: ENSMUSG00000002831
Vega: OTTMUSG00000046184
UniProt: O88492
Position
17; 17 D
AA seq 1403 aa
MSASGDGTRVPPKSKGKTLSSFFGSLPGFSSARNLVSHTHSSTSTKDLQTATDPSGTPAP
SSKVSTNSQMAGDAAGLLQPSEQTAGDKDMGSFSVTSSEDAFSGVFGIMDAAKGMVQGGL
GATQSALVGTKEAVSGGVMGAVGVAKGLVKGGLDTSKNVLTNTKDTVTTGVMGAANMAKG
TVQTGLDTTKSVVMGTKDTVATGLAGAVNVAKGTIQGGLDTTKSVVMGTKDTVTTGLTGA
VNVAKGVVQGGLDTTKSVVMGTKDTVTTGLTGAMNVAKGTAQMGIDTSKTVLTGTKDTVC
AGATGAINVAKGAAQGGLDTTKSVLIGTKDTVTTGLTGAVNVAKGAVQGGLDTTKSVVMG
TKDTVTTGLTGAMNVAKGTAQMGLGTSKTVLTGTKDTVCAGLTGAINVAKGAAQGGLDTT
KSVLMGTKDTVTTGLTGAVNVAKGTIQGGLDTTKSVVMGTKDTVTTGLTGAVNVAKGTIQ
GGLDTTKSVVMGTKDTVTTGLTGAVNVAKGAAQGGLDTTKSVVMGTKDTVTTGLTGAMNV
AKGTAQMGLGTSKTVLTGTKDTVCAGLTGAINVAKGAAQGGLDTTKSVLMGTKDTVTTGL
TGAVNVAKGTIQGGLDTTKSVVMGTKDTVTTGLTGAVNVAKGAVQGGLDTTKSVVMGTKD
TVTTGLTGALNVAKGTAQMGIDTSKTVLIGTKDTVCAGATGAINMAKGAAQGGLDTTKSV
LMGTKDTVTTGLTGAINVAKGSAQGGLDTTKSVLIGTKDTVTTGLTGALNVAKGTVQTGL
DTSQRVLTGTKDNVYAGVTGAVNVAKGTIQGGLDTTKSVVMGTKDTVTTGLTGAVNVAKG
AVQGGLDTTKSVVMGTKDTVTTGLTGAMNVAKGTAQMGIDTSKTVLTGTKDTVCAGLTGA
INVAKGATQGGLDTTKSVLMGTKDTVTTGLTGAINVAKGAAQGGLDTTKSVLLGTKDTVT
TGLTGAANVAKETVQMGLDTSKNILMDTKDSICAGATGAITVVKGAAQGGLDTSNAALTG
TMDTAKGTVQTSLDTSKHMLIGMKDTVCAGVTSAMNMAKGIHKNTDTTRDTQSSVLAHSG
NVATNAIHTGVHTVPSSLSGSHSIICHEPSIYRATNHGVGQAILTSTESLCCETSSFSDK
YGLGHVTEPRADTKTLVSGMASSACAATRSVEECGQLAATGFAALPDELKGLGDIFQPMT
TEEQAQLAVSESGPRVLSADRGSYYIRLGDLAPSFRQRAFEHALSHIQHNQFQARAALAQ
LQEAFQMTDMTMEAACGKLCSDQSLNTMVEAVGSHEMRASVAQDRLCTLAHQLHAAYSSL
VTSLQGLPEVQQQAGQARHSLCKLYGLVSSEAGSELQTEQLAQSSAGVVEAWQGLEVLLE
KLQQNPPLSWLVGPFTSMPCGQL
NT seq 4212 nt   +upstreamnt  +downstreamnt
atgtcagcttcaggagatgggaccagggtcccccccaaatccaaaggcaagaccttgagc
agtttctttgggtccctgcctggcttcagctctgcccggaacctggtgtcccacactcac
agctccacctccacaaaggacttacaaacagcaacagacccctcggggactcctgccccc
tcatctaaagtgtccaccaactcacagatggcaggggatgcagcagggctgctccaacct
tctgaacagacagctggagacaaggacatgggaagtttcagtgtgaccagcagtgaagat
gccttctctggggtgtttggcatcatggatgctgcaaaaggaatggtccagggtggactg
ggtgctacccagtcggcccttgtcggaactaaggaggcagtatctggaggtgtgatggga
gcagtgggcgtggccaaaggtcttgtcaagggaggtcttgacacttcaaagaatgtcctc
accaatacgaaggacacagttaccacaggagtcatgggagctgcaaacatggccaaaggg
acagtacagacaggcctggacaccaccaagtctgtggtcatgggcactaaggacacagtg
gccacaggacttgcaggggctgtgaatgtggctaaaggcaccatccagggtggcctggac
accaccaagtctgtggtcatgggcactaaggacacggtgaccacaggactcacaggggct
gtgaacgtggctaaaggtgttgtccagggtggcctggacactaccaagtctgtggtcatg
ggcaccaaggacacagtaaccacaggactcacaggggccatgaatgtggctaaaggcaca
gcgcagatgggtatagacaccagcaagactgtgctgactggcacaaaggacactgtatgt
gctggggccacaggagccattaatgtagctaaaggggctgcccaaggaggcctggacacc
accaagtctgtgctcataggcaccaaggatacggtgaccacagggctcacaggggctgtg
aacgtggctaaaggtgctgtccagggaggcctggacactaccaagtctgtggtcatgggc
accaaggacacggtaaccacaggactcactggggccatgaatgtggctaaaggcacagca
cagatgggtcttggcaccagcaagactgtgctgactggcacaaaggacactgtatgtgct
gggctcacaggagccattaatgtggctaaaggggctgcccaaggaggcctggacaccacc
aagtctgtgctcatgggtacaaaggacacagtgaccacagggctcacaggggctgtgaac
gtggctaaaggtaccatccagggtggcctggacaccaccaagtctgtggtcatgggcact
aaggacacggtgaccacagggctcacaggggctgtgaacgtggctaaaggtaccatccag
ggtggcctggacaccaccaagtctgtggtcatgggcactaaggacacggtgaccacagga
ctcacaggggctgtgaacgtggctaaaggtgctgcccagggaggcctggacactaccaag
tctgtggtcatgggcaccaaggacacagtaaccacaggactcacaggggccatgaatgtg
gctaaaggcacagcacagatgggtcttggcaccagcaagactgtgctgactggcacaaag
gacactgtatgtgctgggctcacaggagccattaatgtggctaaaggggctgcccaagga
ggcctggacaccaccaagtctgtgctcatgggtacaaaggacacagtgaccacagggctc
acaggggctgtgaacgtggctaaaggtaccatccagggtggcctggacaccaccaagtct
gtggtcatgggcactaaggacacggtgaccacaggactcacaggggctgtgaacgtggct
aaaggtgctgtccagggtggcctggacactaccaagtctgtggtcatgggcaccaaggac
acagtaaccacaggactcacaggggccttgaatgtggctaaaggcacagcacagatgggt
atagacaccagcaagactgtgctgattggcacaaaggacactgtatgtgctggggccaca
ggagccattaacatggctaaaggggctgcccaaggaggcctggacactaccaagtccgtg
ctcatgggtacaaaggacacggtgaccacaggactcacaggggccattaacgtggctaaa
gggtctgcccaaggaggcctggacaccaccaagtctgtgctcattggtacgaaggacacg
gtgaccacagggctcacaggagccttgaatgtggccaaaggaacagtacagacaggtctg
gatactagccagagagtgctgacaggcacaaaggacaatgtatatgctggggtcactggt
gcagtaaatgtggccaaaggtaccatccagggcggcttggacaccaccaagtctgtggtc
atgggcactaaggacacggtgaccacaggactcacaggggctgtgaacgtggctaaaggt
gctgtccagggtggcctggacactaccaaatctgtggtcatgggcaccaaggacacagta
accacaggactcacaggggccatgaatgtggctaaaggcacagcacagatgggtatagac
accagcaagactgtgctgactggcacaaaggacactgtatgtgctgggctcacaggagcc
attaatgtagctaaaggggctacccaaggaggcctggacaccaccaagtctgtgctcatg
ggtacaaaggacacggtgaccacaggactcacaggtgccattaatgttgccaaaggggct
gcccaaggaggcctggataccaccaagtctgtgctcttaggtaccaaggacaccgtgacc
acggggctcacaggggcagcaaatgtggccaaagaaacagtgcaaatgggtctggatacc
agcaagaacatcctgatggacacaaaggactctatatgtgctggggccacaggagccatt
actgtggtcaaaggggctgctcaaggaggcctggatacttcgaacgcagcactcacaggc
acaatggacacggccaaaggaacagtgcaaacaagcctggacaccagcaagcatatgctt
ataggcatgaaggacactgtctgtgctggggttaccagtgccatgaacatggctaaaggt
attcataagaacacagacaccaccagagacacccagtcttctgtgctggctcattcaggt
aatgtagccaccaatgccatccacacaggtgttcacacagttccgagttcactctctggc
tctcattccatcatctgtcatgagcctagcatttacagagccactaaccatggggtagga
caagccatcctgacttctacagagtccctgtgctgtgagacaagcagcttctcagacaaa
tatggcttggggcatgtcacagagcccagagctgacaccaaaacccttgtgtctggtatg
gcttcatctgcctgcgcagctaccaggtcagtggaggagtgtggtcagctggctgccaca
ggctttgctgcacttcctgatgagttgaaagggctgggtgatatctttcagcccatgaca
actgaggaacaagctcagctggcagtctcagagtcagggccccgagtactctctgctgac
cggggaagctactacatccgtctgggtgacctggcccctagcttccgccagcgggccttc
gaacatgccctgagccacatacagcacaaccagttccaagccagggctgcactagcccag
ctccaggaggccttccagatgacagacatgaccatggaggctgcatgtgggaagctgtgc
agtgaccagagcttgaacaccatggtggaggctgttggtagccatgagatgcgggcttcc
gtggctcaggacaggctgtgcaccctcgcccatcagctccatgcagcttacagcagccta
gtaaccagcctgcagggcctgccagaggtgcagcagcaggcagggcaggcacggcacagc
ctctgcaagctgtatggccttgtgtcttcggaggcaggtagtgagctgcagacagagcag
ctggcccagagcagtgctggtgttgttgaggcctggcagggcctggaggtgctgcttgag
aagctgcagcagaaccctccactcagctggctggttggacccttcacctcgatgccttgt
ggccagctgtag

DBGET integrated database retrieval system