KEGG   Mus musculus (mouse): 57438
Entry
57438             CDS       T01002                                 

Gene name
Marchf7, Ax, Axo, Axot, Gtrgeo, Gtrgeo17, Marc, March7
Definition
(RefSeq) membrane associated ring-CH-type finger 7
  KO
K10662  E3 ubiquitin-protein ligase MARCH7 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    57438 (Marchf7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     57438 (Marchf7)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   March proteins
    57438 (Marchf7)
SSDB
Motif
Pfam: RINGv FANCL_C zf-RING_2
Other DBs
NCBI-GeneID: 57438
NCBI-ProteinID: NP_065600
MGI: 1931053
Ensembl: ENSMUSG00000026977
Vega: OTTMUSG00000012814
UniProt: Q9WV66
Position
2; 2 C1.1
AA seq 693 aa
MESKPSRIPRRISVQPSGSLSTRMVSGNRGTSLNDSYHSRDSSFRLDSEYQSASASACAS
PCQPAWYSESEIPQGARARAQTQQRDHDSKRPKLSCTNCASTSAGRNGGSGLNTVSDSSW
RHSQVPRSSSMVLGSFGTDLMRERRDLDRRRESSISNLMDYNHRSGDFTTSSYVQERVPS
SYSQGARPKENAVSTLQLNSSSTNHQLPSDHQTVPSSRDSSRSSFRSHFSPRQSESFRNS
SHPAFSYFSSRNETPTISNSERGSSQRPYRESSDNEGRRTTRRLLSRIASSMSSTFFSRR
SSQDSLNTRSLSSENYISPRTLTSQSRNNGTSSSSDVSEGRAAEASQGFRFLRRRWGLSS
LSQNHSSEPEAENFNQESEGRNSGPWLSSSLRNRCTPLFSRRRREGRDESSRMSTSDVPP
RSHIFRRDSNEVVHLEAQGDSLGAAANRPQASGASSSAAAGGSTPELPQGGRNPGLTGIL
PGSLFRFAVPPALGSNLADNVMITVDIIPSGWNSTDGKNDKAKSAPSRDPEKLQKIKESL
LLEDSDDEEEGDLCRICQMAAASSSNLLIEPCKCTGSLQYVHQECMKKWLQAKINSGSSL
EAVTTCELCKEKLQLNLEDFDIHELHRAHANEQAEYEFISSGLYLVVLLHLCEQSFSDMM
GNTIEPSTRVRFINLARTLQAHMEDLETSEDEF
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggagtctaaaccttccaggattccaagaagaatttctgttcaaccctctggctcttta
agcactaggatggtgtctggaaacagaggaaccagtttaaatgattcatatcattctaga
gactcctcctttagactggattctgaatatcagtctgcatcagcatcagcgtgtgcatca
ccatgtcagcctgcctggtacagtgagtctgagatacctcagggagcgcgggcacgagca
cagacccagcagcgggatcatgactcaaagagacccaagctttcctgtacaaactgtgca
tctacctcagctgggaggaacggtgggagtgggttaaatacagtgtcagattcttcttgg
aggcatagtcaagttcccagatcttcatcaatggtacttggttcatttggaacagacttg
atgagagaaaggagagatttggacaggagaagagagtcctccatcagcaatcttatggat
tataatcaccgaagtggtgatttcacaacttcatcatatgttcaagaaagagttccttct
tcatattcacagggagcaagaccaaaagagaatgcagtgagcactttacagttgaattca
tcatccaccaatcaccaattgccttctgaccatcagacagtaccaagttctagggactcc
agtagaagttctttcagatcacatttttctccaagacaatcagaatcttttcgcaacagt
tcacatcctgcattttcatatttttcaagtagaaatgaaactccaactataagcaattca
gaaaggggttcatctcagagaccatatcgagaatcttctgacaatgaaggtaggcgtaca
actaggagattgctgtcacggatagcttctagcatgtcatctacttttttctcacgaaga
tctagtcaagattccttgaatacaagatctttgagttctgaaaattatatttctccgaga
accctgacttcacagtctcggaataatggaacctcctcgtcctctgacgtcagtgagggc
agggcagctgaagcatctcagggatttagatttcttaggcgaagatgggggttgtcgtcg
ctcagccaaaatcatagctctgaaccagaggcagaaaattttaaccaagaatcagaaggt
agaaattcaggaccatggttgtcttcttcacttagaaatagatgcacacctttgttctcg
agaaggaggcgagagggaagggatgagtcttcaagaatgtctacgtcagatgtaccacct
agatctcatattttcagaagagattcaaatgaagtagttcatcttgaagcacagggtgac
tcccttggggctgctgccaaccgaccacaagcatctggagcgtcaagcagtgctgctgca
ggtggctccaccccagagttgcctcagggtggaagaaatccaggactaacagggattctt
cctggctccttgttccggtttgcagtcccaccagcactcggcagtaatctggctgacaat
gtcatgattactgtagatattattccttctggttggaattcaactgatgggaaaaatgat
aaagctaaaagtgcaccttcaagagacccagaaaaacttcagaaaatcaaagaaagcctc
cttttagaggactctgatgatgaagaagaaggggacttatgtagaatttgtcagatggca
gcagcgtcatcatctaatttattgatagagccgtgcaaatgcacagggagcctgcagtac
gtccatcaagagtgtatgaaaaagtggttacaagccaaaattaattctggctcttcatta
gaggctgtgactacctgtgaactctgtaaagagaagttgcaacttaacctggaggatttt
gatattcatgaactacatagagctcatgcaaatgaacaagctgagtatgagtttatcagc
tctggtctctacctagttgtcttactgcacttgtgtgaacaaagcttttctgatatgatg
ggaaatacaattgaaccaagcactcgtgtccgatttattaaccttgcaagaactcttcag
gcacatatggaagatctcgaaacttcagaggatgaattctga

DBGET integrated database retrieval system