KEGG   Mus musculus (house mouse): 57746
Entry
57746             CDS       T01002                                 
Symbol
Piwil2, Piwil1l, mili
Name
(RefSeq) piwi-like RNA-mediated gene silencing 2
  KO
K02156  aubergine
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    57746 (Piwil2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    57746 (Piwil2)
   piRNA pathway
    57746 (Piwil2)
SSDB
Motif
Pfam: Piwi PAZ ArgoL1
Other DBs
NCBI-GeneID: 57746
NCBI-ProteinID: NP_067283
MGI: 1930036
Ensembl: ENSMUSG00000033644
UniProt: Q8CDG1
Structure
Position
14:complement(70609926..70674338)
AA seq 971 aa
MDPVRPLFRGPTPVHPSQCVRMPGCWPQAPRPLEPAWGRAGPAGRGLVFRKPEDSSPPLQ
PVQKDSVGLVSMFRGMGLDTAFRPPSKREVPPLGRGVLGRGLSANMVRKDREEPRSSLPD
PSVLAAGDSKLAEASVGWSRMLGRGSSEVSLLPLGRAASSIGRGMDKPPSAFGLTARDPP
RLPQPPALSPTSLHSADPPPVLTMERKEKELLVKQGSKGTPQSLGLNLIKIQCHNEAVYQ
YHVTFSPSVECKSMRFGMLKDHQSVTGNVTAFDGSILYLPVKLQQVVELKSQRKTDDAEI
SIKIQLTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPG
YAASIRRTDGGLFLLADVSHKVIRNDSVLDVMHAIYQQNKEHFQDECSKLLVGSIVITRY
NNRTYRIDDVDWNKTPKDSFVMSDGKEITFLEYYSKNYGITVKEDDQPLLIHRPSERQNN
HGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLTQQINLSPKQHHGALECLLQRISQN
ETASNELTRWGLSLHKDVHKIEGRLLPMERINLRNTSFVTSEDLNWVKEVTRDASILTIP
MHFWALFYPKRAMDQARELVNMLEKIAGPIGMRISPPAWVELKDDRIETYIRTIQSLLGV
EGKIQMVVCIIMGTRDDLYGAIKKLCCVQSPVPSQVINVRTIGQPTRLRSVAQKILLQMN
CKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQ
EIVDSLKLCLVGSLKKYYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFDN
YHPKMVVFVVQKKISTNLYLAAPDHFVTPSPGTVVDHTITSCEWVDFYLLAHHVRQGCGI
PTHYICVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQILHHEP
AIQLCGNLFFL
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggatcctgtcaggccgttgttcagggggcccaccccagtccacccatctcagtgtgtg
cggatgccaggctgttggcctcaagctcctagacctttggaaccagcttggggtagggca
ggacctgcaggcagaggccttgtgtttagaaaaccagaagactccagcccaccactccag
ccagtacaaaaggattctgtaggtttggtgtccatgttccgtggcatgggtcttgacaca
gcattccggcctccttcaaaacgagaagtgcctcctttaggcagaggagttctaggtcga
ggcttgtctgctaacatggtccgcaaggacagagaagaaccccgttcctctttgcctgat
ccttcggtgctggcagctggggacagcaaactggcagaggcttctgttggttggagtaga
atgctgggaagaggtagttctgaggtctctctgttaccactgggacgagcagccagtagt
ataggcagaggaatggacaaacctcccagtgcctttggcctcacagctcgggatccccca
cggctgccacagcctccagctctgtctccaacttcactgcactctgccgatccccctccg
gtcctgactatggaacgaaaggaaaaagagcttttggtcaagcaaggatcaaaaggaact
cctcagtctttgggactgaacctcatcaaaatccagtgtcataacgaagcagtttatcag
taccatgtgactttcagccccagtgtggaatgcaaaagcatgaggtttggcatgttgaag
gaccaccagtctgtcactggaaacgtcactgcttttgatggctctattctttatcttcct
gttaagcttcaacaagttgttgagttaaaaagtcagaggaaaactgacgatgccgagatc
agtatcaagattcagctgacaaagatcctggagccgtgttctgacctgtgcatccccttc
tacaatgttgtcttccggcgggtaatgaaacttctggatatgaagcttgtggggagaaac
ttctatgaccctacaagtgccatggtactgcagcaacacagattgcagatctggcctggc
tatgcggctagtatccggaggacagacgggggtctcttcctgctcgctgatgtctctcat
aaggtcattcggaacgactctgtgctggatgtcatgcatgctatctaccagcagaacaag
gagcacttccaggacgagtgcagcaagcttctggttggcagcattgtcatcacgcgctac
aacaatcgtacctaccgaatcgatgatgtggactggaacaagacccctaaagacagcttt
gtcatgtcggacgggaaggaaatcacattcctggaatactacagcaaaaactatgggatc
acagtcaaggaagatgaccagccgctgctgatccaccggcccagtgagagacagaataac
catggcatgttgctgaagggcgagatcctgctgctgcccgagctctccttcatgacgggg
atccctgagaagatgaagaaggacttcagggccatgaaggacttgactcagcagattaac
ctgagccccaagcagcaccacggtgctttggaatgcctgctgcagagaatttcacaaaac
gagacagccagcaatgagctgacccgctgggggctcagtctgcataaagatgtccacaag
attgaaggtcggcttctgccaatggagaggatcaacttaaggaacacttcatttgtcaca
tcggaggacctgaactgggttaaggaagtgaccagagatgcttccattctaactattccc
atgcatttctgggcactcttttatccaaagagagcaatggaccaagccagagaactggtt
aacatgttggaaaagattgccgggcccattggcatgcgcataagccccccagcctgggtt
gagctgaaggatgaccgaatagagacctatatcaggaccattcagtccttactgggagtt
gaggggaagatacaaatggtcgtttgcatcatcatgggcacacgtgatgatctctatgga
gccatcaagaagctgtgctgcgtgcagtccccagtgccctcacaggtcatcaatgtccga
accattggtcagcccaccaggcttcggagcgtggctcagaaaattttacttcagatgaac
tgtaaactgggtggtgagctctggggagtggatattccgctgaaacaactaatggtgatt
ggaatggatgtgtaccatgaccccagcagaggcatgcgctctgtggtcggcttcgtggcc
agcataaatctcacactcaccaaatggtactcgagggtggtgttccagatgccacatcag
gagattgtggacagcctgaagctctgcctggtgggttccttgaaaaagtattatgaggtg
aaccattgtctcccagagaaaattgtggtgtaccgagatggagtgtctgatggccagcta
aagacagttgccaactacgagatccctcagctgcagaagtgttttgaagcctttgataac
taccaccccaagatggtggtgtttgtagttcagaagaaaatcagcaccaatctgtacctt
gctgctcctgatcacttcgtaaccccctcccccgggactgtggttgatcataccataacc
agctgtgagtgggtggatttctaccttcttgcccatcatgtgcgacagggctgtggcata
cctacacactacatctgtgttctgaacactgcaaatctgagccctgatcacatgcagagg
ttgactttcaaactatgccacatgtactggaattggcctggtaccatccgagttccagct
ccttgcaagtatgcccacaagctagctttcctgtccggacagattttgcatcatgagcca
gccatccagctgtgtgggaacctgttcttcctgtaa

DBGET integrated database retrieval system