KEGG   Mus musculus (mouse): 57748
Entry
57748             CDS       T01002                                 

Gene name
Jmy
Definition
(RefSeq) junction-mediating and regulatory protein
  KO
K24045  junction-mediating and -regulatory protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    57748 (Jmy)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    57748 (Jmy)
SSDB
Motif
Pfam: JMY WHAMM-JMY_N WH2
Other DBs
NCBI-GeneID: 57748
NCBI-ProteinID: NP_067285
MGI: 1913096
Ensembl: ENSMUSG00000021690
UniProt: Q9QXM1 A0A0R4J0V4
Position
13; 13 C3
AA seq 983 aa
MSFALEETLESDWVAVRPHVFDEREKHKFVFIVAWNEIEGKFAITCHNRTAQRQRSGSRE
QAGTPASDGSRGPGSPAARGRSEAAASATAALRSPGPRKSQAWAEGGSPRSARSLKGDPP
RGPAGRGPESPLRSPARAKASPLRRSAESRDATASATPAPPAPPVPPVSSVRVVSASGAV
SEEIEVLEMVREDEAPQPLPDSEQPPSAAELESPAEECSWAGLFSFQDLRAVHQQLCSVN
SQLEPCLPVFPEEPSGMWTVLFGGAPEMTEQEIDALCYQLQVYLGHGLDTCGWKILSQVL
FTETDDPEEYYESLSELRQKGYEEVLQRARRRIQELLDKHKTIESMVELLDLYQMEDEAY
SSLAEATTELYQYLLQPFRDMRELAMLRRQQIKISMENDYLGPRRIESLQKEDADWQRKA
HMAVLSIQDLTVKYFEITAKAQKAVYDRMRADQKKFGKASWAAAAERMEKLQYAVSKETL
QMMRAKEICLEQKKHALKEEMQSLQGGTEAIARLDQLESDYYDLQLQLYEVQFEILKCEE
LLLTAQLESIKRLISEKRDEVVYYDTYESMEAMLEKEEMAASVHAQREELQKLQQKARQL
EARRGRVSAKKAYLRNKKEICIAKHHEKFQQRFQSEDEYRAHHTIQIKRDKLHDEEERKS
AWVSQERQRTLDRLRTFKQRYPGQVILKSTRLRVAHSRRKSTASPVPCEEQCHSLPTVLQ
GQEKTEVGGGGSQLGPSQTAEPQSLVQLEDTSSEQLESTSLPPRAVVSSELPPPQSAPLL
TSIDPKPCSVTIDPLPPPLPPTPPPPPPPPPPPPPPLPVAKDNGASTTAETLEKDALRTE
GNERSIPKSASAPAAHLFDSSQLVSARKKLRKTVEGLQRRRVSSPMDEVLASLKRGSFHL
KKVEQRTLPPFPDEDDSNNILAQIRKGVKLKKVQKEVLRESFTLLPDTDPLTRSIHEALR
RIKEASPESEDEEEALPCTDWEN
NT seq 2952 nt   +upstreamnt  +downstreamnt
atgtcgttcgcgctggaggagacactcgagtccgactgggtggcggtgcggccccacgta
ttcgacgagcgcgagaagcacaagtttgtgttcattgtggcctggaacgagatcgaaggc
aagtttgctataacctgtcacaaccggacggcccagagacagaggagcggttcccgggaa
caggcggggacgcccgcgtctgatgggagtcgcggtccgggcagccccgcggccaggggt
cggtcagaggccgctgcctctgctacagcagcgctccggagtcccgggccacggaaaagc
caggcctgggccgagggcggctctccgcgcagcgcgcgcagcctgaagggggatcctcct
cggggtcccgcgggcagaggaccggagagtcctctccgtagccccgcgcgggctaaggcc
agcccgctccgcagaagcgccgaatcccgagatgcgaccgccagtgccacgccagccccg
ccggcgcccccggtgcccccggtgtcgtcggtgcgggtggtgagtgcctccggggcggtc
tccgaggagatcgaggtcctggaaatggtgagggaggacgaggcgccacagccgctcccg
gactcggagcagccgccgtctgccgcggagctggagtctccggccgaagaatgcagctgg
gccgggcttttctccttccaggatctgcgagccgtgcatcagcagctgtgctcggtaaac
tcccagctggagccgtgtctgccggtgttccccgaagagccgtcaggcatgtggacggtg
ctgtttgggggcgcccccgagatgaccgagcaggagatcgacgctctatgttaccaactc
caggtatacctgggccacggcctggacacgtgtggctggaagatcctttctcaggttctt
ttcaccgagacggatgatccggaggagtattacgaaagcctcagcgagctgcggcagaag
ggctatgaagaggtgcttcagcgggccaggaggcgcatccaggagctcttggacaagcac
aagactatagaaagcatggtagagcttttggacttgtatcagatggaggatgaagcctac
agcagccttgcagaggccacaactgaactctaccagtatttacttcagccattccgagac
atgcgagaactggccatgctacgaagacagcagatcaagatttccatggagaatgattat
ttgggccctcgaagaattgagagtctacagaaagaagatgctgactggcagcggaaagct
cacatggctgttttgtctattcaggatctcaccgtcaaatattttgaaataacagcaaaa
gctcagaaagctgtgtatgatcggatgcgagcagatcagaagaaatttggcaaagcatcg
tgggcagcagctgctgagcgaatggaaaaactccagtatgcagtttctaaagagactttg
cagatgatgagagctaaagaaatttgtctggaacagaagaaacatgcactaaaagaagag
atgcaaagcttacagggtggtacagaagctatagctcgattggatcagctggaatctgac
tactatgatctgcaacttcagttgtatgaagtacagtttgaaatcttgaagtgtgaagag
ttgttattaactgcacagctggagagcatcaagagacttatatcagaaaagagagatgaa
gtggtgtactacgacacttacgaaagcatggaggccatgctggagaaggaagagatggca
gcgtctgtgcacgcccagagggaagagctacagaaactgcagcagaaggcacgccagctg
gaagcaagaaggggccgtgtctcagccaagaaagcctacctcagaaataaaaaagaaatt
tgcattgcaaaacaccatgagaagttccagcagcgttttcagagtgaagatgaatataga
gcccatcatacaatacaaataaagagagacaaattgcatgatgaagaggaaagaaaaagt
gcctgggttagccaagagagacagaggacactggatagacttcgaacatttaagcagagg
taccccgggcaagtcatccttaagtcgaccagattacgagtggcgcattcaagaagaaaa
agcacagcaagccctgtgccctgtgaggagcagtgtcactctctgccaacagtgctgcag
gggcaggagaagacagaggtgggaggaggaggaagccagcttgggccttcacagacagca
gaaccccagagccttgtccaacttgaagacacttcatcagaacaacttgaatccacctca
ttacctcctcgtgctgtcgtcagctctgaactgcctcctccacagtcagctccactgttg
actagtattgaccccaaaccgtgttctgttactatagatcctctcccaccccctcttcct
ccaacacctccccctcccccacccccacccccacctccacccccacccctgcctgttgca
aaggacaatggggcctccaccactgcagagacactggagaaagatgcacttaggacggag
ggcaatgagaggagcatcccaaagtcggccagtgcccccgcagcacacctctttgatagc
agccagctggtcagcgcacggaaaaagctcagaaagactgtggaagggctgcagaggagg
agagtgagttcacccatggatgaagtgttagcatccttgaagcgtggtagctttcatctg
aaaaaggttgaacagcggactctgcctccttttcctgatgaagatgatagtaataatatt
ttggcgcagataaggaaaggggtaaagttgaagaaggttcagaaggaagttttgagagaa
tccttcacacttctgcctgataccgaccctttgacacggagtatccacgaagctctaaga
agaatcaaagaagcgtccccagagtcagaggatgaggaagaggctttgccgtgcacagac
tgggagaactag

DBGET integrated database retrieval system